KEGG   Dictyoglomus turgidum: Dtur_0410Help
Entry
Dtur_0410         CDS       T00800                                 

Gene name
fucI
Definition
(RefSeq) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00051  Fructose and mannose metabolism
dtu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dtur_0410 (fucI)
Enzymes [BR:dtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     Dtur_0410 (fucI)
    5.3.1.25  L-fucose isomerase
     Dtur_0410 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C
Motif
Other DBs
NCBI-GeneID: 7081614
NCBI-ProteinID: YP_002352328
UniProt: B8E1T1
Position
412829..414649
Genome map
AA seq 606 aa AA seqDB search
MSRIFPMRIGEKRFIEDYPKVGIRPTIDGRYGGVRESLEEQTMNLAKAVAEFIENNVYLP
NGERVKCVIPQRCIGGVAEARMADELFRKEGVGVSITVTPCWCYGAETMDMSLDIPKAVW
GFNGTERPGAVYLAAVSAAHNQKGLPIFKIYGKDVQDKDDYNIPLDVKEKILKFVKSALA
VAVMKNKSYLSIGSVSMGIAGSIVDPDFFEDYLGMRVEYVDMTEIIRRIERKIYDEEEFK
RAMEWVRKYCKEGEDPNPPDKRVDEKKKQEVWEFVVKMTLIIRDLMVGNKKLEELGYPEE
SLGHNAIVAGFQGQRQWTDHFPNGDFTEAILNTSFDWNGLRQPYILATENDSLNGVVMLF
GHLLTNTAQIFADVRTYWSPEAIYRVTGWKPEGLAQNGVIHLINSGPAALDGTGQQEIEG
KPAIKPFWEISDEEVIKCLDATKFCYANLGYFRGGGFSTKFVTRGEMPVTISRLNIVKGL
GPVLQIAEGYTVELPPHVHEVLDKRTDPTWPTTWFVPKLTGKGAFKSVYSVMENWGANHC
AITYGHVGDLFITLASILRIPVNMHNVEEERIFRPSAWSMFGTEELESADFRACMNFGPL
YKKVAK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaatttttcctatgagaattggggagaaaaggtttattgaggattatcctaag
gtgggaatacgtccaaccattgatggtagatatggtggagtaagagaatcattagaagag
caaaccatgaatttagcaaaagctgtggctgaatttattgaaaacaacgtttatttacct
aatggagagagagttaagtgtgtaattcctcaaaggtgtattgggggagtagctgaagca
agaatggcagatgagctatttagaaaagaaggggtaggagtttctattactgttacgccc
tgctggtgttatggtgcagaaactatggatatgagcttggatataccaaaggcagtctgg
ggttttaatgggactgagagacctggagctgtatatttagcagctgtttctgctgcacat
aatcaaaagggactgcctatatttaagatctatggaaaagatgtacaagataaagacgat
tacaatataccgttagatgtgaaagaaaagattttgaaatttgttaaaagcgccctcgca
gtagcagttatgaagaataaatcttatctttccattgggagtgtttctatgggaattgca
gggtctattgtagatccagacttctttgaagattatttaggaatgagagttgagtatgta
gatatgactgaaattatcagaagaatagagagaaaaatttacgatgaagaagaatttaag
agggcaatggaatgggtgagaaagtattgtaaggagggagaagatccaaatcctcctgat
aagagggttgatgaaaagaagaaacaggaggtttgggaatttgtagttaaaatgactcta
attataagagatttaatggtgggaaataaaaaattagaagaattgggttatcctgaggaa
agcttagggcataatgcgatagttgcaggttttcaaggacaacgtcaatggacagatcac
tttcctaatggcgattttacagaggcaattttaaatacttcctttgattggaatgggtta
agacaaccatatatattggctacagaaaatgatagcctcaatggggtagttatgcttttt
gggcatttgttaacaaatactgctcagatctttgctgatgtaagaacttactggagtcct
gaagcaatttatagagttacaggttggaaaccagagggattagctcaaaacggagtaatt
catctgataaattcaggacctgcagcccttgatggaacaggtcaacaggaaattgaaggt
aaaccagcaataaaaccattctgggagataagtgatgaggaggttataaagtgtttggat
gcaaccaaattctgctatgccaatttaggctactttaggggtggaggattctctactaag
ttcgttacaagaggggaaatgcctgtaactataagtagattaaatatagttaaggggctt
ggtcctgtgttacagattgctgagggatatacagtagaactccctcctcatgttcatgaa
gttcttgataaaaggacagatcctacttggcctaccacttggtttgttcctaaattaaca
gggaaaggtgcttttaagagtgtctattctgtaatggagaattggggggctaatcattgt
gctataacttatggacatgtaggagatttgtttattacccttgcttccattttaagaatc
ccagtgaatatgcataatgtggaagaagaaagaatttttaggcccagtgcctggtccatg
tttggtaccgaagagttagaaagtgcagattttagagcttgtatgaattttggccctttg
tataagaaagtagcaaaataa

DBGET integrated database retrieval system