KEGG   Dictyoglomus turgidum: Dtur_0433Help
Entry
Dtur_0433         CDS       T00800                                 

Definition
(RefSeq) pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00040  Pentose and glucuronate interconversions
dtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dtur_0433
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dtur_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase IF2_assoc
Motif
Other DBs
NCBI-GeneID: 7082454
NCBI-ProteinID: YP_002352349
UniProt: B8E1V2
Position
439114..440487
Genome map
AA seq 457 aa AA seqDB search
MEIKNIILLLTLILLLIITGCSAKESNLVFNVTVLNPPSSVVIDNPYTLNLISTQDAFVT
VYLNDNIVFENYPIKANSTQSINISFSKSRGNNIRVEVRNRNQEKYEYAYENVLYLPKVD
IVVDKNYTGEDGTEINGRKYFKSVLKAMVYITLNQSAYSGRRVYVFIKSGDYYEKVNIMS
PNISLIGEDVNTTRIYYDLAAGSPGAGGTSGSASVTIAGSATGFTAENITFENAFDEIAN
ANISSKQAVAVLSQSDKAVFKNCRFIGNQDTLYVRGGIHYFVDCYIEGDVDFIFGDGRAV
FEKCVIFSVDRAGITPKGYVTAASTKIGNLGFLFTNCELKTNINEEGSVYLGRPWHPSSD
PYSVNSNVVLRNCYMDKHIHPDGWTAMSSKDPNTGETIWFYPDTERFYEYENYGPGAIIN
DKRRQLTGDDVNYYTKENYLGGWDVESFIKNLYEAPN
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaaaatataatattgcttttgactcttatacttttgttgattattactggt
tgttctgcaaaggaaagtaaccttgttttcaatgttacagttttgaatcctccatcttct
gtagttattgataatccctatactctaaacctgatttctactcaagatgcttttgtgact
gtctaccttaatgataacatagtttttgagaactatcctattaaagccaatagtactcaa
agtattaacatatctttttctaaatctcgtgggaacaatattagggttgaagtaagaaac
agaaatcaagagaaatacgaatatgcctatgaaaatgttttgtatctccctaaagtagac
attgtggtagataaaaactatacaggagaagatggtacagagatcaacggtagaaagtat
ttcaagagtgtcttaaaagcaatggtttatataactctgaatcaatctgcatattctgga
agaagagtttatgtatttattaaaagtggagattattatgaaaaagtaaatataatgtct
cctaatatcagccttattggtgaagatgtgaataccacaaggatatattacgatcttgca
gcaggatctcctggagctggtggaacatcaggcagcgccagtgtaactattgcaggtagt
gctactggttttactgcggaaaatattacttttgaaaatgcctttgatgagattgctaat
gcaaatatatccagtaaacaggcagtagcagtattatcccaatctgacaaagctgtgttt
aagaactgtagatttattggtaatcaagataccttgtatgtgaggggtggaattcattac
tttgtagattgctatattgaaggagatgtagatttcatatttggtgatggtagagcagtt
tttgagaaatgtgtaatattctccgtagatagagcaggaattactccaaaaggttatgtc
actgctgcaagtacaaaaataggcaatttgggattcttatttactaattgtgaactgaaa
acaaatataaatgaagaaggttcagtttatcttggtcgtccttggcatccaagctcagac
ccttatagtgtgaattctaatgtggttcttagaaactgttatatggataagcatattcat
cctgatggttggactgccatgagctctaaagatcctaatactggtgagactatatggttc
tatccggatactgagagattttatgagtatgaaaattatggaccaggagcaataataaat
gataagagacgtcagcttacaggagatgatgtaaactattacactaaagaaaactatctt
gggggatgggacgtggaaagctttattaagaatttatatgaggcccctaattaa

DBGET integrated database retrieval system