KEGG   Dictyoglomus turgidum: Dtur_1133Help
Entry
Dtur_1133         CDS       T00800                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00010  Glycolysis / Gluconeogenesis
dtu00051  Fructose and mannose metabolism
dtu00562  Inositol phosphate metabolism
dtu01100  Metabolic pathways
dtu01110  Biosynthesis of secondary metabolites
dtu01120  Microbial metabolism in diverse environments
dtu01130  Biosynthesis of antibiotics
dtu01200  Carbon metabolism
dtu01230  Biosynthesis of amino acids
Module
dtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dtu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_1133 (tpiA)
   00051 Fructose and mannose metabolism
    Dtur_1133 (tpiA)
   00562 Inositol phosphate metabolism
    Dtur_1133 (tpiA)
Enzymes [BR:dtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dtur_1133 (tpiA)
Exosome [BR:dtu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dtur_1133 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dtur_1133 (tpiA)
  Exosomal proteins of melanoma cells
   Dtur_1133 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 7082608
NCBI-ProteinID: YP_002353026
UniProt: B8E2R2
Position
1152030..1152779
Genome map
AA seq 249 aa AA seqDB search
MRRKIIAANWKMYKTCAETESFIKEFKELSKGYEEKEIVICPPFTSLYVANKLLEDTPIK
LGAQNMFWEKEGAYTGEISPIMLKDLNCSYVIIGHSERRQYFSETNDMINKKLKSAFEYE
LIPIFCVGEKWEEREKGKTEEVITEQVKKGLQGLEKEKVEKIVIAYEPVWAIGTGHSAKG
EDANEVAKLIRRIISEIYDEEVSQKVRIQYGGSVNPQNIKEFLAQSEIDGALVGGASLKP
QSFWDIVRS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaggaaaattattgctgctaactggaaaatgtataaaacttgtgcggaaactgag
agttttataaaagaatttaaagaactttcaaaaggttatgaggaaaaggagattgtaata
tgtccacctttcacatctttatatgtagcaaataagcttcttgaagacactcccattaag
cttggtgctcaaaatatgttttgggaaaaggaaggtgcatacacaggggaaatttctcct
ataatgcttaaggatttaaattgtagttatgtaataatagggcattcagagagaagacaa
tatttttctgagactaatgatatgataaacaaaaagcttaaatctgcatttgagtatgag
ctaatacccatattttgtgtgggagaaaaatgggaagagcgagaaaagggaaagacagag
gaagttattactgagcaagtaaagaagggattacaaggtttggaaaaagaaaaagtagaa
aaaattgtaatagcctatgagccagtttgggccataggaacaggtcattctgcaaaaggg
gaagatgctaatgaagtagcaaaactaataagaagaataatttctgaaatatatgatgaa
gaagtctctcaaaaggtgaggatacaatatggtggaagtgtaaatccccaaaacattaag
gaattcttagctcagagtgagattgatggggctttggttggtggagcgagtttaaaaccg
cagtctttttgggatatagttagaagttag

DBGET integrated database retrieval system