KEGG   Dictyoglomus turgidum: Dtur_1644Help
Entry
Dtur_1644         CDS       T00800                                 

Definition
(RefSeq) ABC transporter-like protein
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu02010  ABC transporters
Module
dtu_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Dtur_1644
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     Dtur_1644
Transporters [BR:dtu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    Dtur_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_15 AAA_30 MMR_HSR1 AAA_29 ABC_ATPase AAA_23 TsaE AAA_22 Zeta_toxin DUF2813 AAA_16
Motif
Other DBs
NCBI-GeneID: 7082163
NCBI-ProteinID: YP_002353531
UniProt: B8E343
Position
1659943..1661430
Genome map
AA seq 495 aa AA seqDB search
MNQDLLLKMEKISKSFPGVKALDQVDLEVYKGEILALVGENGAGKSTLMKILTGVYQKDE
GRILFKGKEISPQNPHEAQKLGISIIYQEFNLAPNLDIATNIFLGNEPRKGKFIKIFDYK
KAYEESLKLLDLLGLNLSPDTLVKDLTVAEQQMVEIAKALAQKTELIIMDEPTSALAGRE
VKKLFEIMRRLKSENISIIFITHRLEEVFEIADRIVVLRDGKRVGELPAQRDKYDDVIRM
MVGREIRVIPKPSTKTEEPIFEVRNLSSKKIKNISFQLRKGEVLGIAGLVGAGRTEIIRA
IFGADPIISGEIYLEGKRIEIKSPKDAVQQKIGLVPEDRKLQGLILDMAVYENISLPSLI
YLFPNGIIKKKTEYDLAEYFVKKLQIKTPSIFQKVINLSGGNQQKVVLAKWLALKPKILI
LDEPTRGIDVGAKAEIHRLIGEMAQEGIGIILISSELPEILALSDRILVVSKGRITGEIS
KEEATQEKIMQYAII
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatctcctattaaaaatggagaaaatttcaaaaagctttcctggagtaaaa
gctttggaccaagtagatttagaagtctacaagggtgaaattcttgcccttgtgggagaa
aacggagctggaaaatctacccttatgaaaattctaacaggagtttaccaaaaagacgaa
ggaagaatcctatttaaaggaaaggaaataagccctcaaaatcctcatgaagcccaaaaa
ttaggtatttctattatttatcaagaatttaatttggccccaaaccttgatattgctaca
aacatatttttaggtaatgagcccagaaagggtaaatttataaaaatttttgattataag
aaagcctacgaagaatcattaaaactcttagatttacttggcttaaatttatcaccagac
accttagtaaaagatcttactgtagccgaacaacaaatggtagaaattgcgaaggctctt
gctcaaaaaacagaacttatcataatggatgaacctacctcggctcttgccggaagagag
gttaaaaaactatttgagataatgagaaggcttaaaagtgagaatatttcaataatattt
attactcataggcttgaagaggtatttgaaattgctgacagaattgtagtattaagagat
gggaaaagagttggagaattacctgctcaaagggataagtatgatgatgtaataagaatg
atggtaggaagagagataagagtaataccaaaaccttctacaaaaacagaagaacctatc
tttgaggtaagaaatctatcttctaaaaagatcaaaaatatatctttccaacttagaaaa
ggagaagtcttagggattgcaggtctcgtaggagcaggaagaacagagattattagagcc
atatttggagctgatcctataatttctggagaaatatatctcgaaggaaaaaggattgaa
attaaatcaccaaaggatgcggtacaacaaaaaataggcttagtacctgaagatagaaag
cttcaaggacttattctggatatggcggtttatgagaatatttctttaccttctttaata
tatttattccctaatggaattataaaaaagaaaacagagtatgatcttgctgagtatttt
gttaaaaaactacaaataaaaacgccaagtattttccaaaaagttataaacctctctgga
ggaaatcagcaaaaagttgtgcttgcaaaatggcttgctttaaaacctaagattcttatt
cttgatgaacctacaaggggaatagatgtgggagcaaaagcagaaatacatagacttatt
ggagaaatggctcaagaaggaattggaattatccttatctcttcagaacttcctgaaatt
ctcgccctttctgatagaattcttgtagtatcaaagggaagaatcacaggagaaataagc
aaagaagaagcaacacaggagaaaataatgcaatatgcaataatttaa

DBGET integrated database retrieval system