KEGG   Dyella thiooxydans: ATSB10_08470Help
Entry
ATSB10_08470      CDS       T04308                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00520  Amino sugar and nucleotide sugar metabolism
dtx01100  Metabolic pathways
dtx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ATSB10_08470
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ATSB10_08470
Enzymes [BR:dtx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ATSB10_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_42M
Motif
Other DBs
NCBI-ProteinID: AND68301
UniProt: A0A160MY92
Position
891838..892854
Genome map
AA seq 338 aa AA seqDB search
MLMIGLAGLALEPRERDWLVAPGVSGVLLFARNFSSREQLGALVESIREVGGENMLIAVD
QEGGPVQRFRDGFTRLPALAKVGAAYDRDPVDAIRLAEEHAWVMASELRAMGVDFSFAPV
VDLARGNAAIGLRAFHADPAVAAELGQAYVRGMHLAGMAAVLKHFPGHGSVAADTHKAQA
IDPRPLAAIEQADLVPFAQCLESRVEAVMMAHVIYPAVDERPAGFSPVWIGDVLRGRLGF
DGAVISDDISMAAAGAAGGVAARVHAHLDAGCDLVLACFPDVVDEAIAAVAGRAPGFAHR
LAALRGAIGASWDSLTDNPQRDRFIARITALDAEGTPA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgatcggtctggccgggctcgccctggagccgcgcgaacgcgactggctggtc
gcgcccggtgtgtccggcgtgctgctgttcgcccgcaacttctcctcgcgcgagcaactg
ggtgcgctggtcgagtcgatccgcgaggtcggcggcgagaacatgctgatcgcggtcgac
caggagggcggcccggtgcagcgcttccgcgacggcttcacccggctgccggcgctggcg
aaggtgggagcggcgtacgaccgcgatccggtcgatgccatccggctggccgaggagcac
gcctgggtgatggccagcgaactgcgcgccatgggtgtggatttcagcttcgccccggtg
gtggatcttgcccgaggtaatgcggcgatcggcctgcgcgcgttccacgccgatccggcg
gtggccgccgagttgggccaggcctacgtgcgcggcatgcacctggccgggatggccgcg
gtgctcaagcatttcccggggcacggctcggtggcagccgacacgcacaaggcgcaggcg
atcgacccgcgcccgctggccgccatcgagcaggctgacctggtgccgttcgcgcagtgc
ctggagtcgcgcgtcgaggcggtgatgatggcgcacgtgatctatccggccgtcgacgag
cgtccggccggcttttcgccggtgtggatcggcgacgtcctgcgcggccggctcggcttc
gacggcgcggtgatcagcgacgacatctcgatggccgcggccggtgccgccggcggcgtg
gccgcgcgtgtgcatgcgcacctcgatgccggctgcgacctggtgctggcctgcttcccc
gacgtggtggacgaggccatcgccgccgtggccggccgtgcgccgggtttcgcccatcgc
ctcgcggccctgcgcggcgcgattggtgccagctgggactcgctgaccgacaacccgcag
cgcgaccgcttcatcgcgcgcatcacggcgctggacgccgaaggaacccccgcatga

DBGET integrated database retrieval system