KEGG   Dyella thiooxydans: ATSB10_25870Help
Entry
ATSB10_25870      CDS       T04308                                 

Definition
(GenBank) pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00250  Alanine, aspartate and glutamate metabolism
dtx00330  Arginine and proline metabolism
dtx01100  Metabolic pathways
dtx01110  Biosynthesis of secondary metabolites
dtx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ATSB10_25870
   00330 Arginine and proline metabolism
    ATSB10_25870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dtx03000]
    ATSB10_25870
Enzymes [BR:dtx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     ATSB10_25870
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     ATSB10_25870
Transcription factors [BR:dtx03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    ATSB10_25870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AND70041
UniProt: A0A160N2C1
Position
2769595..2772750
Genome map
AA seq 1051 aa AA seqDB search
MTAPILSPELPDRTTPARARITAAWLRDETEAVLDLLDQASLPDDEREQVVDRAAALVTR
VRARAKDQSVVESFMRQYDLSSEEGVLLMCVAEALLRIPDTRTADKLIRDKLGDANWRKH
LGRSESLLVNASTWGLLLTGQLVNLADGTRDDFTGALRRLVARIGEPTIRGAVRQAMRIM
GHQFVMGRTIEEALDRSVKKENAAYRYSFDMLGEAALTAADAERYQQAYRDAIAALGKRG
PFANHTDAPSISVKLSALFPRYEVAQRERARVALTEKLLELAQLSMKAGIALSVDAEEAD
RLELSLDIIGDVFAHPSLAGWNGLGIVVQAYAKRTPFVIDWLVEMALMHDRRWYVRLVKG
AYWDAEIKKAQEQGLSGYPVFTRKPNTDVSYLACARRLFAAGSHLIYPQFATHNAHTIAA
VHHIAQGRPFEFQRLHGMGADLYAEVIGPKRFDVPCRVYAPVGSHEDLLPYLVRRLLENG
ANTSFVNRVVDEDVPARDLVADPCDTVRAFESIPHPRIPLPANLYGELRKNSMGVNFAND
NELTALAEAVNACTGPWTAGPLVPGAASQGAMVEVTNPADRRQRVGSYLSADDATVQQAL
ANAHAAQDRWNNMPVANRAAMLEYAAEQLEARRAEFIALCVREAGKSLPDAIAEIREAAD
FLRYYATMARRLFAEPEQLPGPTGESNRLYLEGRGVFVGISPWNFPLAIFVGQVSAALAA
GNPVIAKPAEQTSLIGYLATRLLHEAGVPEDVLQFVPGDGATVGAALTRDPRVAGVVFTG
STETAWAINRALAARNSQIAVLIAETGGQNAMIADSSALPEQIVKDVIASAFQSAGQRCS
AARVLYVQDDIADKVITMLAGAMAELKVGDPGLLSTDVGPVIDEDAKAILVEHAARMDKE
AKKIAEAPLDAEVAAHGTFFAPRAYEIPSLDTLKREVFGPVLHVLRWKASELDQVIAAIN
ATGYGLTLGVHSRIDATIDYISRHARVGNCYVNRNQIGAVVGVQPFGGEGLSGTGPKAGG
PHYLLRFAGERTLTINTTAAGGNASLLTIGE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcccatcctgagtcccgaactccccgatcgcaccacgccggcgcgtgcgcgc
atcactgcagcctggctgcgcgatgaaacggaagccgtgctcgacctgctcgaccaggcc
agcctgcccgacgacgaacgcgagcaggtcgtcgaccgcgccgccgccctggtcacccgc
gtccgcgcgcgggccaaggaccagagcgtggtcgaatccttcatgcgccagtacgacctg
tccagcgaggaaggcgtgctgctgatgtgcgtggccgaggcgttgctgcgcatccccgac
acgcgcaccgcggacaagctgatccgcgacaagctcggcgacgccaactggcgcaagcac
ctgggccgcagcgaatcgctgctggtcaacgcctccacctggggcctgctgctcaccggc
cagctggtgaacctcgccgacggcacgcgtgacgatttcaccggcgcgctgcgccggctg
gtcgcgcgcatcggcgaaccgaccatccgcggcgcggtgcgtcaggccatgcggatcatg
ggccaccagttcgtgatggggcggaccatcgaggaagcgctggaccgctcggtaaagaaa
gagaacgcggcctaccgctattcgttcgacatgctgggcgaggccgcactgaccgccgcc
gatgccgagcgctaccagcaggcctaccgcgacgccatcgccgcgctgggcaagcggggg
cccttcgccaaccacaccgatgcgccctcgatctcggtcaagctgtcggcgctgttcccg
cgctacgaagtggcccagcgggagcgcgcccgcgtggcgctcaccgagaagctgctggag
ctggcccaactgtcgatgaaagccggcatcgcgctgtcggtcgacgccgaggaggccgac
cggctggagctgtcgctggacatcatcggcgacgtcttcgcgcacccgtcgctggccggc
tggaacgggctcggcatcgtggtgcaggcctatgccaagcgcaccccgttcgtgatcgac
tggctggtcgagatggcgctgatgcacgaccgccgctggtacgtacgcctggtcaagggc
gcctactgggacgccgagatcaagaaggcgcaggagcagggcctgtcgggctacccggtg
ttcactcgcaaaccgaacaccgacgtgtcgtatctggcctgcgcacgccgcctgttcgcc
gccggcagccacctgatctatccccagttcgccacccataacgcgcacaccatcgccgcg
gtgcatcacatcgcgcaggggcgtccgttcgagttccagcgcctgcacggcatgggcgcg
gacctgtacgccgaggtgatcggacccaagcgcttcgacgtgccgtgccgggtgtacgcg
ccggtgggttcgcacgaggatctgctgccctacctggtgcggcgcctgctggagaacggt
gccaacaccagcttcgtcaaccgcgtggtggacgaggacgtaccggcccgcgacctcgtc
gccgacccctgcgatacggtgcgtgcgttcgagtcgattccccacccgcgcatcccgctg
ccggccaacctctacggtgaacttcggaagaattccatgggcgtcaactttgccaacgac
aacgaactgaccgcgctcgccgaggcggtcaacgcatgcaccggtccgtggaccgccggc
ccgctggtgccgggcgcggccagccagggcgcgatggtcgaggtcaccaacccggccgac
cgccgccagcgcgtgggcagctacctcagcgccgacgacgccaccgtgcagcaggcgctg
gccaacgcccacgccgcgcaggaccgctggaacaacatgccggtggccaaccgcgcggcg
atgctggaatacgccgccgagcagctcgaggcgcgccgcgccgagttcatcgcgctgtgc
gtgcgcgaggcgggcaagagcctgcccgacgcgatcgccgaaatccgcgaggccgccgac
ttcctgcgctactacgccaccatggcgcggcgcctgttcgccgagccggagcagctgccc
gggccgaccggcgagagcaaccgcctgtacctggaaggccgcggcgtattcgtcgggatc
agcccgtggaacttcccgctggcgatcttcgtcggccaggtcagcgccgcgctggctgcc
ggcaacccggtgatcgccaagcccgccgagcagaccagcctgatcggctacctcgccacc
cggctgctgcacgaagccggcgtgccggaggacgtgctgcagttcgtgccgggcgacggc
gccaccgtcggcgccgcactgacccgcgacccgcgcgtggccggcgtggtgttcaccggc
tcgaccgaaaccgcctgggcgatcaaccgcgcgctggccgcgcgcaattcgcagatcgcc
gtgctgatcgccgagaccggcggccagaacgcgatgatcgccgactcctccgcgctgcct
gagcagatcgtcaaggacgtgatcgcctcggcgttccagtccgccggccagcgctgctcg
gcggcccgcgtgctgtacgtgcaggacgacattgccgacaaggtgatcaccatgctggcc
ggcgcgatggccgagctgaaggtcggcgatcctggcctgctgtctaccgatgtcggcccg
gtgatcgacgaagacgccaaggcgatcctggtcgagcacgccgcccgcatggacaaggag
gcgaagaagatcgccgaggcaccgctggacgcggaagtcgctgcgcacggcaccttcttc
gccccgcgcgcttacgagatcccctcgctggacacgctcaagcgcgaggtgttcggcccg
gtgctgcacgtgctgcgctggaaggccagcgaactggaccaggtgatcgccgcgatcaac
gccaccggctacggcctcacgctcggcgtgcacagccgcatcgacgccaccatcgactac
atcagccgtcatgcgcgtgtcggcaactgctacgtcaaccgcaaccagatcggcgcggtg
gtcggcgtgcagccgttcggcggcgagggcctctcgggcaccggcccgaaggcgggcggt
ccgcactacctgctgcgcttcgccggcgagcgcacgctcaccatcaacaccacggcggcc
ggcggcaacgcctcgctgctgaccatcggcgaatga

DBGET integrated database retrieval system