KEGG   Dyella thiooxydans: ATSB10_26870Help
Entry
ATSB10_26870      CDS       T04308                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
dtx  Dyella thiooxydans
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dtx03016]
    ATSB10_26870
Enzymes [BR:dtx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ATSB10_26870
Transfer RNA biogenesis [BR:dtx03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ATSB10_26870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AND70141
UniProt: A0A160N2L9
Position
2881792..2882493
Genome map
AA seq 233 aa AA seqDB search
MIEILHQDDALIAVNKPAGLAVHRSKMVGNAESFLIDELRAQVGDTVYLAHRLDRATSGV
LLVARSSEVAAALGEQFMGRDVHKDYLAVVRGWPEPAEGLVDYPLPGSRDTGPRREARTR
YRRLATVEVPIPLGRYPQQRYALVACAPETGRFRQIRKHMAHIHHPIIGDCQHGRSDHNR
LYKQYFGCHRMLLHARRITLRHPLEGTPLVIEAPLDAAWTALLDRFGWSIEGA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagatactccaccaggacgacgccctgatcgcggtgaacaagcccgcgggcctg
gccgtgcaccgctcgaagatggtgggcaacgccgagagcttcctgatcgacgagctgcgc
gcccaggtcggcgacaccgtgtacctggcgcaccggctcgaccgcgcgaccagcggcgtg
ctgctggtcgcgcgatccagcgaggtggccgccgcactcggcgagcagttcatgggccgt
gacgtgcacaaggactatctggccgtggtgcgcggctggcccgagcccgccgaggggctg
gtcgactacccgttgcccggctcgcgcgacaccgggccgcgccgcgaggcgcgcacccgc
taccggcggctggccacggtcgaggtgccgatcccgctgggccgctatccgcagcagcgc
tacgcgctggtcgcctgcgcgccggagaccggccgcttccggcagatccgcaagcacatg
gcgcacatccaccacccgatcatcggcgactgccagcacgggcgcagcgaccacaaccgg
ctgtacaagcagtacttcggctgccatcgcatgctgctgcacgcacgccgcatcacgctg
cggcatccgctcgagggcacgccgctggtgatcgaggcgccgctggatgcggcctggacc
gcgctgctggaccgcttcggctggtcgatcgaaggggcctga

DBGET integrated database retrieval system