KEGG   Dyella thiooxydans: ATSB10_26920Help
Entry
ATSB10_26920      CDS       T04308                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00620  Pyruvate metabolism
dtx00630  Glyoxylate and dicarboxylate metabolism
dtx01100  Metabolic pathways
dtx01110  Biosynthesis of secondary metabolites
dtx01120  Microbial metabolism in diverse environments
dtx01200  Carbon metabolism
Module
dtx_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATSB10_26920
   00630 Glyoxylate and dicarboxylate metabolism
    ATSB10_26920
Enzymes [BR:dtx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ATSB10_26920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AND70146
UniProt: A0A160N2L6
Position
2885400..2886992
Genome map
AA seq 530 aa AA seqDB search
MAVPQERLQPIQAQIHADTTGYEDILTPDALAFLARLHHAAEARRQQLLKARHERQARYD
AGCLPNFRSDTRAIREGDWRVAPIPEALLDRRVEITGPVERKMIINALNSGAKVFMADFE
DSSAPSFRNQLDGQINLRDAVAGTIEHTSPEGKRYRLAEQTAVLVVRPRGWHLPERHVTV
DGQTMAGALVDFGLFAYHNAHLLHAMQRGPYFYLPKLEAMEEAALWDEVMALAEAELDLP
AGCMKATVLIETLPAVFQMHEILHALRHRVVGLNCGRWDYIFSYLKTLRGHRDRLLPERG
QVQMTVPFLKAYSELLIQTCHRRGAFAMGGMAAQIPIKGDEAANEAAMAKVRADKLREVT
AGHDGTWVAHPALVPVAKAIFDEHMPTPNQLDRLREDVCVSREQLLAPCAGSISREGFDN
NVEVALRYTAAWLDGLGCVPIHHLMEDAATAEIARAQLWQWLHHGGVEFTDHAPIDFALF
DQVLAKHAHRLRGSSDPGAAKADAAAALLSALTHDDQLADFLTLPAYEQL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaccccaggaacgcctgcagccgatccaggcgcagatccacgccgacaccacc
ggctatgaggacatcctcacgccggacgcgctggctttcctcgcccggctgcaccatgcg
gcggaggcccgccgacagcaattgctgaaggcgcggcatgagcgccaggcccgctatgac
gccggctgcctgccgaacttccgcagcgacacacgcgccatccgcgagggcgactggcgc
gtggcgccgattcccgaagcgctgctggaccgtcgggtcgagatcaccgggccggtcgaa
cgcaagatgatcatcaacgcgctgaactccggcgcgaaggtattcatggccgacttcgag
gattcctcggcgccgagcttccgcaaccagctcgatggccagatcaacctgcgcgatgcg
gtggctggcaccatcgagcacacctcgcccgagggcaagcgctaccggctggccgagcag
accgccgtgctggtggtccgtccgcgcggctggcacctgcccgagcgacacgtcaccgtc
gacggtcagaccatggccggagccctggtcgacttcggcctgttcgcctaccacaacgcc
cacctgctgcacgcgatgcagcgtggtccgtacttctacctgcccaagctcgaggcgatg
gaggaagccgcgctgtgggacgaggtgatggcgctggccgaggccgagctcgacctgccg
gccggctgcatgaaggccacggtgctgatcgagacgctgccggcggtgttccagatgcac
gagatcctgcatgcgctgcgccatcgcgtggtcggcctgaactgcggccgctgggactac
atcttctcctacctgaagaccctgcgcgggcaccgcgaccgcctgctgcccgagcgcggc
caggtgcagatgacggtgccgttcctgaaggcctactccgagctgctgatccagacctgc
catcgccgtggcgccttcgcgatgggcggcatggccgcgcagatcccgatcaagggcgac
gaagccgccaacgaggcggcgatggccaaggtgcgcgccgacaagctgcgcgaggtgacc
gccggtcacgacggcacctgggtcgcgcacccggcgctggtgccggtggcgaaggcgatc
ttcgacgagcacatgcccacgccgaaccagctcgaccggctgcgcgaggacgtctgcgtc
agccgcgaacagttgctcgcaccctgtgccggctcgatcagccgcgagggtttcgacaac
aacgtcgaggtggccctgcgctacaccgcggcctggctcgatggcctgggctgcgtgccg
atccaccacctgatggaggacgccgccaccgccgagatcgcccgcgcgcagctgtggcag
tggctgcaccacggcggggtcgagttcaccgatcacgcgccgatcgacttcgccctgttc
gaccaggtgctggccaagcacgcgcaccggctgcgcggaagcagcgacccgggtgccgcg
aaggccgatgccgccgccgccctgctgtcggcactgacccatgacgaccagctcgccgac
ttcctgaccctgcccgcgtacgaacagctctga

DBGET integrated database retrieval system