KEGG   Dyella thiooxydans: ATSB10_27680Help
Entry
ATSB10_27680      CDS       T04308                                 

Definition
(GenBank) hypothetical protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00053  Ascorbate and aldarate metabolism
dtx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ATSB10_27680
Enzymes [BR:dtx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     ATSB10_27680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40
Motif
Other DBs
NCBI-ProteinID: AND70222
UniProt: A0A160N437
Position
2961287..2962207
Genome map
AA seq 306 aa AA seqDB search
MSGVRLLPAMQPVMDVGNTLGEGIVWCDRAQSLFWTDIPQATLYRWHPDSDTLQTWAMPE
RLASFALCEDDGWLLLALASRLAFFRLDDGHLEPLHAVEPGMATRSNDGGCDRQGRFVFG
TLHEPTSGAKQAVGGFWRLDAALALEKLDLPGVAISNSIAFSPDGGTMYFCDSLTRQIHC
CDYGDTLGPPRLFARVDGDTGEPDGSCVDAEGNLWSAQWGRGRVVCYTPDGAVLRVLPLP
ASQPTRAAFGGAQLDTLYVTSAREGLSDATLIAEPRAGALFRSRVGAQGLREPRFAGRPG
ALAASG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggtacggctgctgcccgcgatgcagccggtgatggatgtcggcaacacgctg
ggcgagggcatcgtctggtgcgaccgcgcgcagtcgctgttctggaccgacatcccgcag
gccacgctgtaccgctggcatcccgacagcgacaccctgcagacctgggcgatgcccgag
cggctggcctcgttcgcattgtgcgaggacgacggctggctgctgctggcgctcgcttcg
cggctggcgttcttccgcctggacgacggccatctcgagccgctgcacgccgtcgagccc
ggcatggccacgcgcagcaacgacggcggctgcgaccgccagggccgcttcgtgttcggc
acgctgcatgagccgacgtccggcgccaagcaagcggtcggtggcttctggcgactggat
gcggcgctggcgctggagaagctggacctgcccggcgtggcgatcagcaactccatcgcc
ttcagtcccgacggcgggaccatgtacttctgcgactcgctgacccggcagatccactgc
tgcgactacggcgacacattgggtccgccgcgcctgttcgcccgcgtcgacggtgacacc
ggcgagcccgacggctcctgcgtggacgccgagggcaacctgtggagcgcgcagtgggga
cgcggccgggtggtctgctacacgccggatggtgcagtgctccgtgtgctgccgcttccg
gcaagccaacctacccgggcggctttcggcggtgcgcaactggacacgctgtacgtcacc
agtgcccgcgaaggtctctccgacgccacgctgatcgccgagccccgggccggcgccctg
tttcgttcgcgcgtcggcgcgcagggactgcgcgaaccccgttttgccggtcgccccggg
gcacttgccgcctccggttga

DBGET integrated database retrieval system