KEGG   Dyella thiooxydans: ATSB10_30490Help
Entry
ATSB10_30490      CDS       T04308                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00071  Fatty acid degradation
dtx00072  Synthesis and degradation of ketone bodies
dtx00280  Valine, leucine and isoleucine degradation
dtx00310  Lysine degradation
dtx00362  Benzoate degradation
dtx00380  Tryptophan metabolism
dtx00620  Pyruvate metabolism
dtx00630  Glyoxylate and dicarboxylate metabolism
dtx00640  Propanoate metabolism
dtx00650  Butanoate metabolism
dtx00900  Terpenoid backbone biosynthesis
dtx01100  Metabolic pathways
dtx01110  Biosynthesis of secondary metabolites
dtx01120  Microbial metabolism in diverse environments
dtx01130  Biosynthesis of antibiotics
dtx01200  Carbon metabolism
dtx01212  Fatty acid metabolism
dtx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dtx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATSB10_30490
   00630 Glyoxylate and dicarboxylate metabolism
    ATSB10_30490
   00640 Propanoate metabolism
    ATSB10_30490
   00650 Butanoate metabolism
    ATSB10_30490
  Lipid metabolism
   00071 Fatty acid degradation
    ATSB10_30490
   00072 Synthesis and degradation of ketone bodies
    ATSB10_30490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATSB10_30490
   00310 Lysine degradation
    ATSB10_30490
   00380 Tryptophan metabolism
    ATSB10_30490
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATSB10_30490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATSB10_30490
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ATSB10_30490
Enzymes [BR:dtx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATSB10_30490
Exosome [BR:dtx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATSB10_30490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AND70503
UniProt: A0A160N3E7
Position
3278337..3279620
Genome map
AA seq 427 aa AA seqDB search
MDNSQRRVGVIGGVRIPFCRNNTAYAEVGNFGMSVKVLGALVERFGLHGVELGEVALGSV
IRLSSEWNLAREAVLSSGLAPTTPAITTARACGTSLDNAIIVANKIAAGQIEAGIAAGSD
TTSDVPIVYGERLRKRLLAVNRAKTPLDKLKTAFRGFSFGELKPAFPGVAEPRTGMSMGD
HCEKMAREWHIARQAQDELALESHRKLAAAYDAGFFDDLIVPFRGLKRDGFLRPDSTLEK
LAALKPAFDKSSGHGTLTAGNSTGLSDGAAAVLLGTEAWASEHGLTVQAWLRDAEVAAVD
FVRGEGLLMAPTIAVPRMLARHGLTLQDFDYYEIHEAFAAQVLCTLRAWESADYCKQRLG
LDAPLGSIDPARLNVHGSSLATGHPFAATGARIIATLAKLLEQKGSGRGLISICTAGGMG
VTAILER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggacaactcgcagcggcgcgtcggcgtgatcggtggcgtgcggattcccttctgccgc
aacaacacggcgtatgccgaggtcggcaatttcggcatgtcggtgaaggtgctgggggcc
ctggtcgagcgcttcggactgcacggcgtggaactgggcgaggtcgcactgggctcggtg
atccggctgtcctcggagtggaacctggcgcgcgaggcggtgctgtcttccggcctggcg
ccgaccacgccggcgatcaccaccgcgcgcgcctgcggcacttcgctggacaacgcgatc
atcgtcgccaacaagatcgccgccgggcagatcgaggcgggcatcgccgccggctcggat
accaccagcgacgtgccgatcgtctatggcgagcgcctgcgcaagcggctgctggcggtc
aaccgtgccaagaccccgctggacaagctcaagaccgcgttccgcggcttctccttcggc
gaactcaagccggcattcccgggcgtggccgaaccgcgcaccggcatgtcgatgggtgac
cactgcgagaagatggcgcgcgagtggcacatcgcgcgccaggcccaggacgagctggcg
ctggaaagccaccgcaagctcgccgccgcctacgacgcgggcttcttcgacgacctgatc
gtgccgttccgcggcctcaagcgcgacggcttcctgcgtccggattccacactggagaag
ctcgccgcgctgaagccggcgttcgacaagagctccggccacggcacgctcaccgccggc
aactccaccggcctgtccgacggcgccgcggcggtgctgctgggtaccgaggcatgggcc
agcgagcatgggttgaccgtgcaggcgtggctgcgcgacgccgaggtggctgcggtggat
ttcgtccgtggcgagggcctgctgatggcgccgacgatcgccgtgccgcggatgctggcg
cgtcatggactcacgctgcaggacttcgactactacgagatccacgaggcgttcgccgcg
caggtgctgtgcacgctgcgcgcgtgggagagcgccgactactgcaagcagcgcctcggc
ctggatgcgccgctgggcagcatcgatccggcaaggctgaacgtgcacggctcgagcctg
gccaccggccacccgtttgccgccaccggcgcgcggatcatcgccacgctggccaagctg
ctggagcagaagggatcgggccgcggcctgatctcgatctgcaccgccggcggcatgggc
gtgacggcgatcctcgagcgctga

DBGET integrated database retrieval system