KEGG   Dyella thiooxydans: ATSB10_36050Help
Entry
ATSB10_36050      CDS       T04308                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00350  Tyrosine metabolism
dtx00643  Styrene degradation
dtx01100  Metabolic pathways
dtx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ATSB10_36050
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    ATSB10_36050
Enzymes [BR:dtx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     ATSB10_36050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AND71059
UniProt: A0A161J832
Position
3921583..3922251
Genome map
AA seq 222 aa AA seqDB search
MLQDLALYGYWRSTAAYRVRIALALKGLDWENHPVHLVRDGGEQHGASYRAINPQELVPA
LVDGERVFTQSLAIVEYLDETVPEPPLLPVDPRGRARVRALAQTIACDIHPLGNLRVLQA
LEARFGATEAQRADWNRHWMAVGLAAFEAMLADNVATGTFCHGDEPGLADICLIPQLYNA
ARWQLPLDAYPTIRRIQAECVALPAFQVAAPERQPDAPPAGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggatctcgcgctttatggctactggcgttcgaccgccgcctaccgcgtgcgc
atcgcgctggcgctgaaagggctggactgggaaaaccacccggtccacctggtgcgcgat
ggcggcgagcagcacggggcctcctaccgggcgatcaatccgcaggagctggtgcccgcg
ctggtcgacggcgagcgggtgttcacccagtcgctggcgatcgtcgaatacctggacgag
acggtgccggagccgccgctgctgccggtggacccgcgcggacgggcacgcgtccgggcg
ctggcgcagaccatcgcctgcgatatccacccgctgggcaacctgcgggtactgcaggcg
ctggaggcgcgcttcggcgccaccgaggcgcagcgggccgactggaaccgtcactggatg
gccgtgggcctggctgcgttcgaggcgatgctggccgacaacgtggccaccggtacgttc
tgccacggcgacgagccggggctggccgacatctgcctgatcccgcagctctacaacgcc
gcgcgctggcagctgccactggatgcgtaccccacgatccgccgcatccaggccgaatgc
gtggccttgccggcgtttcaggtggcggcgccggagcgccaaccggatgctccgcctgcc
ggcgcctga

DBGET integrated database retrieval system