KEGG   Dermabacter vaginalis: DAD186_08510Help
Entry
DAD186_08510      CDS       T04434                                 

Definition
(GenBank) cysteine-tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
dva  Dermabacter vaginalis
Pathway
dva00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dva00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DAD186_08510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dva01007]
    DAD186_08510
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dva03016]
    DAD186_08510
Enzymes [BR:dva01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     DAD186_08510
Amino acid related enzymes [BR:dva01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   DAD186_08510
Transfer RNA biogenesis [BR:dva03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DAD186_08510
 Prokaryotic type
    DAD186_08510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 Metal_resist
Motif
Other DBs
NCBI-ProteinID: ANP27401
UniProt: A0A1B0ZHJ0
Position
972002..973438
Genome map
AA seq 478 aa AA seqDB search
MTLRLHDSKTRTVSDFTPLKDGEVSLYVCGPTVQDGPHVGHIRTFLAFDVLVRWLRRSGY
RVTYVRNVTDIDDKILARAAEEGEAWWKWSYTNERKFGEIMDQLGAVRPDYEPRATGHVT
EMIDFMQRLIERGHAYADGEGSVYFDVSSLPEYGSLTNQSIENMVDDAEAASNLKQDPRD
FALWKKAKAGEPETAKWSTPFGEGRPGWHLECSAMAKKYVGESFDIHGGGLDLRFPHHEN
EQAQSYGAGYGFAQRWMHSGMLTVDGMKMGKSLGNFITAEDVLAKHPAAAVRLAIVGSHY
RTNVEFNDTTLAEAETVLSRLRGSLTRALDALEQAGAHEELCEPGEGALPDRFTEAMNDD
LGVADALAVVHERHGQLNTLLAKPHIDAHEVASAVNELRDMLDVFGLDLLGAMWSDEPGA
GGAEHDALDALIRAQLEERAEARKNKDWASADAIRDRFAAAGIRIEDSAGSSRWSLTN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgactctacgactgcacgattcgaaaaccagaacagtttcggacttcaccccgctcaag
gacggtgaagtctcgctctacgtgtgcgggcccacggtccaagacggcccccacgtgggg
catatccgcacgttcctcgcgttcgacgtgctcgtgcggtggctgcgcaggagcggctac
cgagtcacctacgtgcgcaacgtgaccgacatcgacgataagatcctcgcgcgcgccgcc
gaagagggcgaggcttggtggaagtggtcctacacaaacgaacgaaaattcggtgagatc
atggatcagctcggcgccgtgcgccccgattacgagccgcgcgccacggggcacgtcacc
gagatgatcgacttcatgcagcgcctcatcgaacgtggacacgcctacgccgacggtgag
ggaagcgtgtacttcgacgtctcctcgctgcccgaatatggttcgctcacgaaccagtcg
atcgagaacatggtcgacgacgccgaagcagcctcgaacctcaaacaggaccctcgagac
ttcgcactgtggaagaaagccaaggcaggcgaacccgagaccgccaagtggtcgacacct
ttcggcgaggggcgccccgggtggcacctcgagtgctcggccatggcgaagaaatacgtg
ggggagagcttcgatatccacggcggtggcctcgacttgcgcttcccccatcacgaaaac
gagcaggctcagagctacggcgccggctacggatttgcgcagcgttggatgcactcgggc
atgctcaccgttgacggcatgaagatgggcaagagcctcggcaacttcattacagccgag
gatgtcctcgcgaagcacccggcggccgccgtgcgcctcgccatcgttggctctcactac
cgcacgaacgtcgagttcaacgacacgacgcttgccgaggcggaaactgtactctcgcga
cttcgcggctcgctcacgcgcgccctcgacgcgctcgagcaggcaggagcacacgaagag
ctttgcgaacccggcgagggagcgcttcccgaccgcttcaccgaggcgatgaatgacgac
ctcggcgtcgccgatgctctcgcagtcgtccacgaacgacacgggcaactcaataccctt
ctcgcgaaaccgcacattgatgctcatgaggttgcaagtgccgtcaacgagctgcgagac
atgctcgatgttttcggtctcgacctgctcggcgcgatgtggtccgatgagcctggcgcg
ggtggtgcggagcacgacgctctcgatgccctcatccgagcgcagctcgaggagcgcgca
gaagcacggaaaaacaaggactgggcgagcgccgatgcgattcgcgatcgcttcgctgcc
gccggcattcgcattgaagactccgcgggctcctcccgctggagtctcacgaactag

DBGET integrated database retrieval system