KEGG   Dermabacter vaginalis: DAD186_09640Help
Entry
DAD186_09640      CDS       T04434                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dva  Dermabacter vaginalis
Pathway
dva00450  Selenocompound metabolism
dva00970  Aminoacyl-tRNA biosynthesis
dva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DAD186_09640
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DAD186_09640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dva01007]
    DAD186_09640
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dva03016]
    DAD186_09640
Enzymes [BR:dva01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DAD186_09640
Amino acid related enzymes [BR:dva01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DAD186_09640
Transfer RNA biogenesis [BR:dva03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DAD186_09640
 Prokaryotic type
   Other AARSs
    DAD186_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ANP27514
UniProt: A0A1B0ZHQ6
Position
complement(1096438..1098234)
Genome map
AA seq 598 aa AA seqDB search
MSTVLSAVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVAA
DQEGITARELADRNNRVIVEDLVNLGLSYDLFTRTTSGNHYAIVQEMFTTVRDNGYMIEK
VTRGAISPSTGRTLPDRYIEGTCPLCKTPGARGDQCDACGNQLDPTDLIDPVSKINGETP
KFIETTHYFLDLPALADALGKWLDEREATGLWRPNVIRFSQNILKDIKPRAMTRDIDWGI
PVPGWEDQPTKRLYVWFDAVIGYLSASIEWARRTGDPEAWRKWWNDPEALSYYFMGKDNI
VFHSQIWPAELIAHNGGGSKGGEPGRLGTLNLPTEVVSSEFLTMEGKKFSSSKGVVIYVR
DVLERYQADALRYFISAAGPENQDADFTWSEFVSRTNNELVAGWGNLVNRTAAMIAKNVG
EIPAAGELTEADNALLTKITEGFDTVGNLIRTHRQRAAIAEIMHLVGEANAYVSATEPFK
LKAEEERPRLLTILHVLAQAVTDLNTMLSPFLPFSANQVEKVLGGTLEIAPMPRIEEVED
LDADATYPIITGDYTHVPAWGHRDVTVGAPVAKPKPIFQKLDPSIVEEELERLGVASE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtgctttctgctgtcgcctggccctatgcaaacggaccccgccacatcggc
cacgttgccggattcggtgtcccctccgatgttttctcgcgctacatgcgcatggccggg
cacgacgtgctcatggtctcgggaaccgatgaacacggaaccccgatcctcgtggctgcc
gatcaagaaggaattacggcgcgcgagcttgccgatcgcaacaaccgcgtgatcgttgag
gacctcgtgaacctcgggctctcctacgacctattcacgcgcacgacttccggcaatcac
tacgcgatcgtgcaggaaatgttcacgaccgtgcgcgacaacggctacatgatcgaaaag
gtgacgcggggcgcaatctccccgtcgaccggccgcacactccccgaccgctacatcgaa
ggcacatgcccgctgtgcaagacacccggcgcccgcggcgaccaatgcgacgcatgcggc
aaccaactcgacccgaccgacctcatcgacccggtctcaaagatcaacggcgaaaccccg
aagttcatcgaaaccacccactacttcctcgacctgcccgcactcgccgatgcactcggc
aagtggctcgatgagcgcgaggccacggggctgtggcgcccgaacgtgattcgcttcagt
cagaacatcctcaaggacatcaagccacgcgcgatgacccgcgacatcgactggggcatc
cccgttcccggctgggaagatcagcccacgaagcgcctatacgtgtggttcgatgccgtg
atcggttacctctccgcttcgattgagtgggcgcgccgcaccggcgatccggaagcgtgg
cgcaagtggtggaacgaccccgaggctctttcctactacttcatgggcaaggacaacatc
gttttccactcgcagatttggccggctgagctcattgcgcacaacggcggcggcagcaag
ggcggtgagccgggaaggctcggcaccctcaatcttccgacggaggtcgtgagttcggag
ttcctcacgatggaggggaagaagttttcgagctcaaagggcgtcgtcatttatgtgcgc
gatgtcctcgaacgctaccaggccgatgccctgcgctacttcatttccgcggctggcccc
gaaaaccaggacgcagacttcacgtggagcgagttcgtgtcgcgcacgaacaacgagctc
gttgccggatggggcaacctcgtgaaccgcaccgctgccatgatcgccaagaacgtgggt
gaaattcccgcagctggcgagctcacggaagcagacaacgccctcctgacgaagatcacc
gagggctttgacaccgtcggaaacctcattcgcacccaccgccagagggcggccattgcc
gaaatcatgcatctcgtgggagaagcgaacgcgtacgtgtcggcgaccgagccgttcaag
ctcaaagccgaagaagagcgccctcgcctcctcacgattctgcatgtactggcgcaggcc
gtgaccgacctcaacacgatgctctcgccgttcctgccgttctccgcaaaccaggtcgag
aaggttctgggcggcacgctcgagatcgcgccgatgccacgcatcgaagaggttgaggat
ctcgatgccgacgccacctaccccatcatcacgggcgattacacgcacgttcctgcgtgg
gggcatcgcgatgtcacggtgggcgctccggtcgcaaagcccaagccgattttccagaag
ctcgaccccagcattgtcgaagaggagctcgagcgcctcggggtcgcaagcgaatag

DBGET integrated database retrieval system