KEGG   Dermabacter vaginalis: DAD186_18060Help
Entry
DAD186_18060      CDS       T04434                                 

Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
dva  Dermabacter vaginalis
Pathway
dva00670  One carbon pool by folate
dva01100  Metabolic pathways
dva01120  Microbial metabolism in diverse environments
dva01200  Carbon metabolism
Module
dva_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:dva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DAD186_18060
Enzymes [BR:dva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     DAD186_18060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ANP28356
UniProt: A0A1B0ZK79
Position
2009915..2011591
Genome map
AA seq 558 aa AA seqDB search
MASENPDLKIAQAHTLKPITEIAEAAGIPNDALIPYGWTKAKVDMKKIDQSSDKPKAKLV
LVSALSPTPAGEGKSTTTVGLSDAFSLKGKKTVVALREPSLGPVMGVKGGATGGGYAQVV
PMEDINLHFTGDFHAIQIANNTLAALIDNSIQQGNPLNIDPRRIQWKRVLDVNDRELRSI
VVGLGGPAQGMPREDGFDIVVASEIMAILCLATDLKDLQERISRIVVGYTFDRKPVTVAD
LKVEGAITMLLKDALNPNLVQTLGGTPALVHGGPFANIAHGCNSIIATNLARELGEIAVT
EAGFGSDLGGEKFLDIKSRFGGFSPDAVVLVATVRALKMHGGVKKDELETENVDAALEGT
ANLRKHLENIRKFGLEPVIALNRFPSDTETELKAVLDWAKENGYKAALSEVWAKGGEGAL
DLADQVLAAIEEAGDFHHLYEPEDGVENAIETIAKEVYGASEVQYVDGAPAALRRLKKNG
WDKLPVCMAKTQYSFSDDPSKLGAPEGHVLHVRDLIPRLGAGFVVALTGSVMTMPGLPKE
PAALRMGVDEDGNAIGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgaaaaccctgatctcaagatcgcccaggcccacaccctcaagccgatcacc
gagatcgccgaggccgccggtatcccgaacgacgccctcatcccctacggctggaccaag
gcaaaggtcgacatgaagaagatcgaccagagcagcgacaagccgaaggcgaagctcgtg
ctcgtttcggcgctctcgccgacccccgcgggcgaaggtaagtcgacgacgaccgtcggc
ctttccgacgccttctccctcaagggcaagaagaccgtcgtcgcactccgcgaaccctcg
ctcggcccggtcatgggcgtcaagggcggcgcaaccggtggtggctacgcccaggtcgtc
cccatggaagacatcaacctccacttcacgggcgacttccacgcgatccagattgcgaac
aacaccctcgccgccctcatcgacaactcgatccagcagggcaaccccctcaacattgac
ccgcgccgtattcagtggaagcgcgtcctcgacgtcaacgaccgcgagctccgctcgatc
gtcgtcggcctcggcggccccgcccagggcatgccccgcgaagacggcttcgacatcgtc
gtggcctccgagatcatggcgatcctctgcctcgcgacggacctcaaggatctgcaggag
cgcatctcgcgcatcgtcgtgggctacacgttcgatcgcaaacccgtgaccgtcgccgac
ctcaaggtcgaaggcgccatcacgatgcttctcaaggatgccctcaacccgaacctcgtg
cagaccctcggcggcacccccgccctcgtgcacggcggcccgttcgccaacatcgcgcac
ggctgcaactcgatcatcgcgaccaacctcgcccgcgagctcggtgaaatcgccgtgacc
gaggccggcttcggctcggacctcggcggcgaaaagttcctcgacatcaagtcgcgtttc
ggcggcttctcgcccgacgcggtcgtgcttgtcgcgaccgtgcgcgccctcaagatgcac
ggcggcgtgaagaaggacgagctcgaaacggagaacgtcgacgcggccctcgaaggcacc
gcgaacctccgcaagcacctcgagaacattcgcaagttcggtctcgagcccgtcatcgcc
cttaaccgcttcccgtcggacaccgagaccgagctcaaggccgttctcgactgggcgaag
gagaacggctacaaggctgcactctccgaggtgtgggcaaagggcggcgagggtgcactc
gacctcgccgaccaggtgctcgccgccatcgaggaagccggcgacttccaccacctctac
gagcctgaggacggcgttgagaacgccatcgagaccatcgccaaggaggtctacggcgca
tcggaggtccagtacgtcgacggtgctcccgcagcccttcgccgcctcaagaagaacggc
tgggacaagctccccgtgtgcatggcgaagacccagtactcgttcagtgacgacccctcg
aagctcggcgcacccgagggccacgtgctccacgttcgcgacctcatcccccgcctcggc
gccgggttcgtggtcgcgctcaccggttcggtcatgaccatgccgggtctgccgaaggag
cccgcggcactgcgcatgggcgtcgatgaggacggcaacgcgatcggcctcttctaa

DBGET integrated database retrieval system