KEGG   Desulfovibrio vulgaris RCH1: Deval_0431Help
Entry
Deval_0431        CDS       T02064                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00260  Glycine, serine and threonine metabolism
dvg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01130  Biosynthesis of antibiotics
dvg01230  Biosynthesis of amino acids
Module
dvg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_0431
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deval_0431
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deval_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADP85602
UniProt: A0A0E0SZ92
Position
542286..543473
Genome map
AA seq 395 aa AA seqDB search
MKKGYFGDFGGRFVPELLMPPLMEIEAAMRDIMPTQAFRHELDDLLHNFAGRETPLTRCD
TLSRELGCTLWLKREDLLHTGAHKVNNTLGQALLARRMGKTRLVAETGAGQHGVATAAAA
ARLGLSCIVFMGAVDVERQSANVMRMKLLGAEVVPVESGTRTLKDAINETLRYWIAEQGS
THYCFGTAAGPHPFPTLVRDFQAVIGHETRRQMLERTGALPDMVVACVGGGSNAIGMFHA
FVDDADVRIVGVEAAGTGEPGCYNSAPINLGSPGVLHGNRTMLLQDGDGQILPSHSVSAG
LDYPGVGPEHAHLGATGRVVYGMVTDTQALAAFKALTRAEGIIPALESSHAVAWVLENPH
LLPQGGNVVVNLSGRGDKDMDIVREHLFPSLGGKA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttacttcggcgatttcggcggcaggttcgtgcctgaactgctgatgccg
cccctgatggagattgaggcggccatgcgcgacatcatgcccacgcaggcattccgccat
gagcttgacgacctgctgcacaacttcgcagggcgtgagacccccctcacccggtgcgac
accctgtcgcgtgaactcggctgcaccctgtggctgaaacgtgaagacctgctgcacacc
ggggcgcacaaggtgaacaacaccctcgggcaggcgttgctggcccggcgcatgggcaag
acgcgtctcgtggcggagaccggcgcggggcagcatggcgtggccaccgcagcggcggcg
gcacggctggggctgtcgtgcatcgtcttcatgggggcggtggatgtggaacgccagtcc
gccaacgtcatgcgcatgaagctgctgggggcggaggtcgtgcccgtggaaagcggcacg
cgcaccctcaaggacgccatcaacgagaccctgcgctactggatagcggaacagggcagt
acgcactactgcttcggcacggcggcggggccgcaccccttccccacgctggtgcgcgac
tttcaggctgtcatcggtcacgagacccggcggcagatgctggaacgcacgggtgcgctg
cccgacatggtggtggcgtgcgtgggcggcggttccaatgccatcggcatgttccacgcc
ttcgtggacgatgcggacgtgcgcatcgtgggtgtcgaggccgcaggcacgggcgaaccg
gggtgctacaactccgcacccatcaaccttgggtcgccgggggtgctgcatggcaaccgt
accatgctgctacaggacggcgacggacagatactgccgtcgcactccgtctcggcggga
ctcgactaccccggtgtggggccggaacatgcccatctcggggccacggggcgcgtggtc
tacggcatggtcaccgacacgcaggcgcttgccgcattcaaggcactcacccgcgccgag
ggcatcatccccgcgctggaatcgtcgcacgcggtggcatgggtgcttgagaacccgcat
ctgctgccgcagggcggcaatgtggtggtgaacctttcgggacgtggcgacaaggatatg
gacatcgtgcgggaacacctgttccccagcttgggaggcaaggcatga

DBGET integrated database retrieval system