KEGG   Desulfovibrio vulgaris RCH1: Deval_0645Help
Entry
Deval_0645        CDS       T02064                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00620  Pyruvate metabolism
dvg00630  Glyoxylate and dicarboxylate metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
dvg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deval_0645
   00630 Glyoxylate and dicarboxylate metabolism
    Deval_0645
Enzymes [BR:dvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deval_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADP85811
UniProt: A0A0E0SZS3
Position
783326..785515
Genome map
AA seq 729 aa AA seqDB search
MTGRIREGGLAVAEPLHRCIEREILPGTGISPSIFWAGLEELVGTLGPRNRELLARRDNM
QAAIDAWHKEHQGRPHDAAAYRRFLEDIRYLLPAPQDLAVETQGVDPEVATIAGPQLVVP
VTNPRYALNAVNARWGSLYDALYGSDVIADSDGAARGAAYNPLRGAKVVAYAAAFLDRTF
PLAGARHADVVRYELTGPPVGRKLSALCADGTVTGLLHPDAFAGYTGGERPTTVLLRNNG
LHVELQFDRRHPVGAAHPAGLKDVVLESAVTTILDCEDSVATVDAEDKALAYRNLLGLFR
GDLETSFDKGGRSVFRRLAADRTYTAPGGAAYALPGRSLMLVRNVGLLMTTDAVLDAAGQ
EIPEGILDGLVTACIGLHDLRGAGRHRNSGAGSVYIVKPKLHGPEEVAFVCEQFRRIEDI
LGMARNTLKMGVMDEERRTTLNLAECIRVASQRIIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAQRWMLAYEDWNVDTGLAAGFGGKAQIGKGMWPKPDRLAEMVATKGAHPRAGANC
AWVPSPTAATLHALHYHEVDVFARQRELAGCHRASLDDLLALPLMGEARPSPAEVREELE
NNAQSILGYVVRWVEMGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGICTEDEVR
DVMLRMATVVDRQNKDEPGYRPMSADPGSSVAFRAACDLVFEGARQPNGYTEPILHARRR
EVKARSLTR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcatacgtgaaggcggcctcgctgtggccgaacccctgcaccgttgtatc
gaacgcgagattctgccgggcaccggcatctccccctccatcttctgggcggggctggaa
gagcttgtcggcaccctcggcccccgtaaccgcgaattgctggcccgacgggacaacatg
caggcggcgatagacgcatggcacaaggagcatcaggggcggccgcacgatgccgcagcc
tacaggcgttttctcgaagacatccgttatctgcttcccgcaccgcaggacctcgcggtt
gaaacgcagggggtcgaccccgaagtggcgaccatcgccgggccgcaacttgtcgtgccc
gtgaccaacccccgctatgccctcaatgccgtcaacgcccgctggggcagcctctacgac
gccctgtacggcagcgacgtgattgccgacagcgacggggctgcacgtggcgctgcctac
aatcccctgcggggcgcgaaggtggtggcgtatgccgccgcgttcctcgacaggacattc
ccgttggccggggcgaggcatgccgacgtggtgcgctacgagttgaccgggccaccggtg
ggtcgcaagctgtcggccctctgtgccgacggtacggtgacgggcctgctgcatcctgat
gcgttcgccggctatacggggggagagcgcccgacgacggtgctgctgcgcaacaacggg
ctgcatgtcgaattgcagttcgaccgcaggcacccggtgggggctgcccaccctgcggga
ctcaaggatgtggtgctcgagtcggcggtgaccaccatcctcgattgcgaggattccgtg
gccaccgtcgatgccgaagacaaggccctcgcctatcgcaacctgcttggactgttccgg
ggcgaccttgagacctcgttcgacaagggcgggcgcagcgtcttcaggcgtctggcagca
gacaggacgtacaccgcaccgggcggggcagcgtatgccctgccggggcgcagcctgatg
ctggtgcgtaacgtggggctgctcatgaccaccgacgccgtgctcgacgcggcagggcag
gagattcctgaaggcatcctagacgggctcgtcaccgcctgcatcgggctgcacgacctg
cgcggtgcggggcgtcatcgcaacagcggagccggcagcgtgtacatcgtcaaacccaag
ctgcatggccccgaagaggtggcgttcgtctgcgagcagttcagacgcatcgaagacatc
ctcggcatggcgcgcaataccctcaagatgggggtgatggacgaggaacggcgaaccacg
ctcaatcttgcggagtgcatacgggtggcttcgcagcgtatcatcttcatcaatactggc
ttcctcgaccgtacgggcgacgagatacacacctgcatggaggcggggcccgtcgtgcgc
aagaacgacatgaaggcccagcgctggatgctcgcctatgaggactggaacgtggacacc
gggcttgccgccggtttcggcggaaaggcccagataggcaagggcatgtggcccaagccc
gacaggctggcggagatggtcgccaccaagggggcgcacccgcgtgccggggccaactgc
gcgtgggttccctctccaacggcggcgacgctgcacgccctgcactaccatgaggtggat
gtcttcgcgcgtcagcgcgaacttgccggatgtcaccgggcgtcgctggacgaccttttg
gcattgccgctcatgggtgaggcgcgtccctcgcccgctgaagtgcgcgaagaactggag
aacaacgcccagagcatcctcggctacgtggtacggtgggtcgagatggggataggctgc
tcgaaagtgcccgatatccatgacgtgggtctcatggaagacagggccaccctgcgtatc
tccagccagcacatcgccaactggttgcgccatggcatctgcacggaggacgaggtgcgt
gacgtcatgctacggatggcgaccgtggtcgacaggcagaacaaggatgaaccgggctac
cggcccatgtctgccgaccccggttccagcgtggcgttcagggcggcatgcgacctcgtg
ttcgagggggcgcgccagcccaacgggtataccgaacccatcctccatgcccgcaggcgc
gaggtgaaggcgcgtagtctcacccggtag

DBGET integrated database retrieval system