KEGG   Desulfovibrio vulgaris RCH1: Deval_0798Help
Entry
Deval_0798        CDS       T02064                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00350  Tyrosine metabolism
dvg00360  Phenylalanine metabolism
dvg00380  Tryptophan metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Deval_0798
   00360 Phenylalanine metabolism
    Deval_0798
   00380 Tryptophan metabolism
    Deval_0798
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvg04147]
    Deval_0798
Enzymes [BR:dvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Deval_0798
    4.1.1.105  L-tryptophan decarboxylase
     Deval_0798
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deval_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DUF1896
Motif
Other DBs
NCBI-ProteinID: ADP85962
UniProt: A0A0E0T0A2
Position
complement(964179..965681)
Genome map
AA seq 500 aa AA seqDB search
MGHMPEAETTTMPPFETLDLDDLHGDLTRVAGMIADRIAHIADAPVVHPASHDAIVAAIP
GDLPVEGIGVDAALQEVADHVAPFATRIGHPRFLAWITTSPAPAGTIGDVLCTGLNQAPL
SFKGGPAATVLEEIVLGWFHRLLGFPEGAGGTIVSGGTMANLMGLTVARHAHFPEVGTRG
LCALDKTPVLYVSDQGHMSIERSAALLGLGSENVRAIPSDAACRIIPEALRERIRADRAA
GFAPFCVVGQAGTVTAGAVDPLDALADICADEGLWLHVDAAYGGAALLTQHGRSLLHGIE
RADSVCVDPHKWFFIPLECGCTLFRDRTVQTDTFKAKAAYLGQESPHDLKNTTFILSRAN
RALKVWFAFRTYGTAKLARIIERNMAQARLFHDLCTESPEWQVLAPVALSIACARFVPSA
MAGAPHWDEAATDRLQVALLQRLEQSGEGFLTPALVRGRAGVRLCVANHRTTDDDIRMLF
DLMSRFGRELAALGPEGLHA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggacacatgccggaggcggagaccacgaccatgccacccttcgagacgctcgacctc
gacgacctgcacggcgacctcacccgcgtcgccggaatgatcgccgaccgcatcgcgcac
atcgccgacgccccggtggtgcatcccgcctctcacgacgccatcgtcgccgccattccc
ggtgacctgcccgtggagggcatcggcgtggacgccgccttgcaggaggtcgccgaccat
gtggcgcctttcgccacccgcatcggacacccgcgctttctcgcatggataaccaccagc
ccagcacccgccggaaccatcggcgacgtgctctgcaccggtctcaatcaggcaccgctc
tcgttcaagggcggccccgccgccacagtgctcgaggagatcgtactcggctggttccac
agactgctgggcttccccgaaggggcgggcggcaccatcgtctccggcgggaccatggcc
aatctcatgggcctcaccgtcgcgcgccatgcacacttcccggaggtcggcacgcgaggc
ctgtgtgcgctcgacaagacgcccgtgctctacgtctccgaccaggggcacatgtccatc
gaacgttcggcggccctgcttggcctcggcagcgagaacgtccgggccatcccttccgac
gcggcatgccgcatcatcccggaggcgctgcgcgagcgcatccgcgccgacagggccgcg
ggcttcgcccccttctgtgtcgtggggcaggcaggcaccgtcaccgccggggccgtcgac
cctctggacgcgctggccgacatctgcgccgacgaaggcctgtggctgcatgtcgacgca
gcctatggcggtgctgccctgctgacgcagcacggtcgctcgctgctgcacggcatcgaa
agggccgactcggtctgcgtcgacccgcacaaatggttcttcatccccctcgaatgcggc
tgcaccctcttccgcgaccgcaccgtgcagaccgacacgttcaaggccaaggcggcctat
ctcggccaggaaagcccacacgacctgaagaacaccacgttcatcctgagtcgggccaac
cgcgccctgaaggtctggttcgccttcaggacatacggcacggcgaaacttgcacgcatc
atcgaacgcaacatggcgcaggcgcggctttttcatgacctgtgcaccgaatcacccgag
tggcaggtgctcgccccggtggccctctccatcgcctgtgcccggttcgtcccttccgcc
atggcgggggcaccgcactgggatgaggccgcgaccgaccgccttcaggtcgccctgctg
caacgactcgaacagtcgggagaaggctttctcacccccgcacttgtgcgcggccgcgca
ggtgtccgtctgtgtgtcgccaaccatcgaaccaccgacgacgacatacgaatgctgttc
gacctcatgtcccgcttcggacgtgagcttgcggccctcgggccggaaggactgcacgca
tga

DBGET integrated database retrieval system