KEGG   Desulfovibrio vulgaris RCH1: Deval_0830Help
Entry
Deval_0830        CDS       T02064                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00230  Purine metabolism
dvg01100  Metabolic pathways
Module
dvg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Deval_0830
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Deval_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 MobB AAA_18 AAA_16 AAA_25 AAA MMR_HSR1 MEDS TsaE IstB_IS21 AAA_24 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADP85994
UniProt: A0A0E0T0L2
Position
996990..997613
Genome map
AA seq 207 aa AA seqDB search
MGRERSGIVLVLCAPSGTGKTTLTRRLLTEFPRFAFSVSYTTRKPRNGEVDGKDYHFVTV
EAFLRLRDAGFFAEWAEVHGNFYGTPLKATLDLLDEGRDVLFDIDVQGARQLRASLQRGR
YVFIMPPSRDELEHRLRARGTDDEETIARRLANAAKELREARRFDAWIVNDDLERAYDEL
RAAYIEETLSPECRSAFLDGLLQGWND
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagaacgctccggcatcgtgctggtgctgtgcgccccttcggggaccggcaag
accaccctgaccagaaggctgctgacggagtttccgcgtttcgccttctcggtctcctac
accacgcgtaaaccccgcaatggcgaggtggacggcaaggactaccattttgtcaccgtg
gaggcgttcctgcgcctgcgcgacgccggattcttcgccgaatgggccgaagtgcacggc
aacttctacggtacgcccctcaaagccacactcgaccttcttgatgaaggccgcgacgta
ctcttcgacatcgacgtgcaaggtgcgcggcagttgcgtgcaagcctgcaacgcgggcgc
tacgtcttcatcatgccgccatcgcgcgacgaactcgagcacaggctgagggcgcgcggc
accgacgacgaggagaccatagcccgccgtctcgccaacgcggccaaggaactgcgcgag
gcgcgccgcttcgatgcgtggatagtcaacgacgacctcgaacgcgcctacgatgagttg
cgtgccgcctacatcgaggagacgctgtccccggaatgccgttcggcgttccttgacgga
ttgctgcaggggtggaacgactga

DBGET integrated database retrieval system