KEGG   Desulfovibrio vulgaris RCH1: Deval_1615Help
Entry
Deval_1615        CDS       T02064                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00010  Glycolysis / Gluconeogenesis
dvg00051  Fructose and mannose metabolism
dvg00562  Inositol phosphate metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
dvg01130  Biosynthesis of antibiotics
dvg01200  Carbon metabolism
dvg01230  Biosynthesis of amino acids
Module
dvg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvg_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_1615
   00051 Fructose and mannose metabolism
    Deval_1615
   00562 Inositol phosphate metabolism
    Deval_1615
Enzymes [BR:dvg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deval_1615
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deval_1615
  Exosomal proteins of bladder cancer cells
   Deval_1615
  Exosomal proteins of melanoma cells
   Deval_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADP86768
UniProt: A0A0E0T2Q0
Position
1826182..1826937
Genome map
AA seq 251 aa AA seqDB search
MKKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVLVCPPFTALHALHDTFKDVEG
FAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLK
AGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGKV
AGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL
QAVSFSRIILA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcatcgccgccaattggaaaatgtacaagaccatcgacgaggctagggct
acgggacgcgaacttgtgtccgccgtcgccgggtcactgcccgcagaccgtgaggtgctc
gtgtgcccccccttcacggcgctccatgcccttcatgacaccttcaaggacgtcgagggg
tttgccatcggcgggcaggatgtctacccggctaccgaaggggcctacaccggcgaaatc
gcacccggcatgttgctcgatgccggatgcggatgggtgctcaccgggcactctgaacgg
cgtcatattctcggtgaggacgacgagacggtcgcgcgcaagacggctttcagcctgaag
gccggactgcgtgtggtactgtgcatcggcgaaaagcttgatgaacgtgaggctggcagg
cttgaagacgtgctggcgcatcagctgcaggtcgggcttgcagatgtcgacgcgacctat
gtaccccagtcgcttgtggtggcctacgaacccgtatgggctatcggtacgggcaaggtg
gcggggcctgccgaagtcgtcgaggctcacgctcttgtccgttcgctactcgaagcccgt
tacggtcgcgacggtgccgccatacgcatcctgtacgggggcagcgtgaagcctgacaac
gccgcagaactactttctcttgacaatgtcgacggtctgctggtaggaggcgcttctttg
caggctgtcagcttcagccgcatcattctggcatga

DBGET integrated database retrieval system