KEGG   Drosophila virilis: Dvir_GJ10211Help
Entry
Dvir_GJ10211      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6 Lipase_2
Motif
Other DBs
NCBI-GeneID: 6632748
NCBI-ProteinID: XP_002056471
FlyBase: FBgn0197498
UniProt: B4M4M2
Position
Unknown
AA seq 376 aa AA seqDB search
MSPDELPISERHNSGNNSNNAGNMGQTADEQLLRLQDYNLLYNAERQTYFQLHSSNWRGT
NRPPPSGGNRLLQQVVGNTLSAAFGLNANDDNVKNTSMEMTTTQTVRLYDAASLRQSRFN
PFQPTRIIIHGWLGNAHANVYSYLVPAYMTLGDGNYNIFTVDWGRGAIADYITASYRVKP
VGQVLAKFLDFLHEEAGMRFEDLQLIGFSMGAHVAGLASKHLQTGRVRVIRALDPALPFF
RYAQEKERLSRSDADYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWRAF
ALFKESLEKMAFEAKGCETSEWQQLTRYKRCPQPTGQRLHMGGDLGELSMEQLAQRMGVY
YFETQAKAPYDMGAAL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgacgagctgccaatatcggaaaggcataattctggcaacaacagcaacaat
gcgggcaacatgggccaaacggctgatgagcaactattgcgattacaggactacaattta
ctgtacaatgccgagcggcagacatactttcagctgcactcgagcaattggcgtggcaca
aatagaccgccgccatcgggtggcaatcgactgttgcagcaggttgttggcaacacgctg
agcgccgcctttggcctgaatgcgaatgacgataatgttaagaatacttccatggagatg
accaccacgcaaacggtgcggctctatgatgccgcctccttgcgacaatcgcgcttcaac
ccattccaaccgacgcgcatcataatacacggctggctgggcaatgcacatgccaatgtc
tacagctatttggtccccgcctacatgaccctcggcgacggcaactacaatattttcacc
gtggactggggccgtggcgccattgccgactatataacggccagctatagggtgaagcct
gtgggtcaggtgctggccaagtttctggactttctgcacgaggaggctggcatgcggttt
gaggatctgcagctgattggcttcagcatgggcgcccatgtagctggcctggcctcaaaa
catttgcaaacgggccgcgtgcgtgtgatacgcgccttggatccagctttgccgtttttt
cgctatgcccaggagaaggagcgactgagtcgcagcgatgcggactatgtggaggtattg
cacacgagcgtgggaagctatggatttgatcgcccactgggccacgtggacttctatgcc
aattggggcagccagcagccgggctgcttttggcacgagtgcagccattggcgtgccttt
gccctcttcaaggagagcctggagaagatggccttcgaggccaagggttgtgagaccagt
gaatggcagcagttgacgcgctacaagcgctgtccacaacccacgggccaacggctgcac
atgggcggcgatttgggcgagttatcaatggagcagctggcgcagcgtatgggagtttat
tattttgagacccaggcgaaggcaccgtacgatatgggcgcagcattatag

DBGET integrated database retrieval system