KEGG   Drosophila virilis: Dvir_GJ11813Help
Entry
Dvir_GJ11813      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06627  cyclin-A
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dvi03032]
    Dvir_GJ11813
   03036 Chromosome and associated proteins [BR:dvi03036]
    Dvir_GJ11813
DNA replication proteins [BR:dvi03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    Dvir_GJ11813
Chromosome and associated proteins [BR:dvi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    Dvir_GJ11813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 6624681
NCBI-ProteinID: XP_002047644
FlyBase: FBgn0199067
UniProt: B4LDM5
Position
Unknown
AA seq 511 aa AA seqDB search
MASFQIHRDNCEKENPGMLNLKEKGAVAKQPLAVIGGKEKALAPRANLVVLNTNNNHGNV
PRGNPAPPGKVGFREIAKLKVDENIGYGGAKKSNVVPVVEQFKTFSVYEDNVDTQAQAQA
NVADKENIQCAGAQKLELVHQEFALQQSYDLDGTPMSVTDVLSPMSVDRSMADASNISSA
QLTDSSHVDDMADLKNAADAAAATENALLPRNDRQRFFEVVQYQRDILQNFRECEKKHRP
KAQYMRRQTDINHSMRTILVDWLVEVAEEYKLDTETLYLSVSYLDRFLSQMSVKRSKLQL
VGTAAMYIASKYEEIYPPDVGEFVFLTDDSYTKAQVLRMENVFLKILSFNLCTPTPYVFI
NTYAVLCDMPEKLKYMTLYICELSLLEGESYMQYLPSLISSASLAFARHILGMPMWTAQL
EEITTYTLEQLKHIVVALCKTHKSARELSTQAIREKYNRDKFKKVATIEPIELSESEIDI
IVQDYKAASKCQTEQQPGNNMKPKVNLFYKF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctttcaaatacatcgtgataactgtgaaaaggagaatcccggcatgctgaat
ctaaaggaaaagggagccgttgcaaagcagccactcgctgtaattggtggcaaggagaag
gctctggcaccgcgcgccaatttagttgtgctgaataccaacaacaaccatggcaatgtg
ccgcgcggcaaccccgcaccccctggcaaagtgggctttcgagaaattgctaagctaaag
gtggacgaaaacattggctatggcggcgccaagaaatcgaacgttgtgcccgttgtggag
caattcaagacattctccgtttacgaggacaatgtcgatacacaggcacaagcccaggcc
aacgttgccgacaaggagaatatacaatgtgctggcgcccagaagctcgaactggtgcac
caggagtttgccttacagcaatcgtacgatctggatggcacgcccatgtccgtcaccgat
gtgctatcgcccatgtctgtggaccggtccatggcggatgccagcaatatcagcagcgcc
cagctaactgacagcagccatgtcgatgatatggctgatcttaagaatgctgctgatgcc
gctgcagccacggaaaatgcgctactgccgcgcaacgatcgccagcgcttcttcgaggtg
gtccagtatcagcgcgatattttgcagaatttccgcgagtgcgagaaaaagcatcgccca
aaagcgcaatacatgcgtcgtcaaactgacatcaatcactcgatgcgcaccattctggtt
gattggctggtcgaagtcgccgaggaatacaaactggacacggagactctgtacttatca
gtctcatatttggatcgcttcctcagccagatgtcggtgaagcgctccaagctgcaattg
gttggcacggcagccatgtacattgcttccaaatatgaggagatctacccaccagatgtt
ggcgagtttgtctttctcactgacgacagctatacaaaggcccaagtgttgcgcatggag
aatgtgtttctaaaaattctatccttcaacttgtgcacaccaacaccctacgtcttcatc
aacacctatgccgtgctgtgcgatatgcccgagaagctgaagtacatgacattgtacatt
tgtgagctgtccctgttggagggagaatcttatatgcaatatttgccctcgctcatttcg
tctgcttcgcttgcatttgcacgtcacattcttggtatgccgatgtggacggcgcagctg
gaggagattaccacgtacacactggaacaattgaagcatatagttgtggcgctgtgcaag
acgcacaagtcagccagagagctaagcacgcaggctataagggaaaagtacaatagggac
aaattcaagaaagtggccacaattgagcccattgaactgagcgaatctgaaatcgatatt
attgtacaggattataaggcggccagcaagtgccagacagagcagcagccgggcaacaat
atgaaacctaaagtcaatttgttttataagttttaa

DBGET integrated database retrieval system