KEGG   Drosophila virilis: Dvir_GJ11980Help
Entry
Dvir_GJ11980      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvi  Drosophila virilis
Pathway
dvi00040  Pentose and glucuronate interconversions
dvi00052  Galactose metabolism
dvi00500  Starch and sucrose metabolism
dvi00520  Amino sugar and nucleotide sugar metabolism
dvi01100  Metabolic pathways
Module
dvi_M00361  Nucleotide sugar biosynthesis, eukaryotes
dvi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ11980
   00052 Galactose metabolism
    Dvir_GJ11980
   00500 Starch and sucrose metabolism
    Dvir_GJ11980
   00520 Amino sugar and nucleotide sugar metabolism
    Dvir_GJ11980
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dvir_GJ11980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6623733
NCBI-ProteinID: XP_002047348
FlyBase: FBgn0199232
UniProt: B4LBA2
Position
Unknown
AA seq 520 aa AA seqDB search
MTSGIRPIDVLLQRAGMRGHQRAPSDSKEFHEVTKRDALRLLENDVDRLLQTTEPARRPA
LQAEMGRFADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKKFIGEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPFEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLN
MEIIVNNKTLENGLRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaggcatacgacccattgatgtgctgctgcaacgcgccggtatgcgcggccat
cagcgcgccccatccgattcgaaggagttccatgaggtaaccaagcgcgatgcactgcgt
ctgctggaaaacgacgtggatcgtctgctgcagaccacggaaccggctcgtcgaccagca
ctccaagctgaaatgggtcgatttgcggatctgtttggtcgcttcctgcaagaggaggga
ccagcgctggattggaataaaatccaaaagctgcccgaaaatgcggtcatgaactactcc
aatctcaagtcgcccaaaaacgagcagaatgagattcgcaatatgttggacaaactggtg
gtcattaagctgaatggtggtctgggcacctcgatgggttgccatggacccaagagtgtt
atacctgtgcgttccgatttgacattcttggatctgacggtgcagcaaatcgagcatctg
aataagacatacgatgccaatgtgccgctggtgctgatgaactccttcaatacggatgag
gacacggaaaagattgtgcgcaagtacaagggcttccgcgtgcagatacacaccttcaac
cagagctgctttccacgcatcagtcgcgagcatttcctgccggttgccaaggatttcgat
gtggaaaaggacatggaggcctggtatccacctggtcacggtgacttctacgataccttc
cgtaactcgggtctgctgaagaagttcattggcgagggccgggaatactgtttcctgtcc
aacattgacaatctaggcgccaccgtcgatctgaacatactcaacaagctggtgggcgag
gagcgcgccagcacgccattcgagttcgtcatggaggtcaccgacaagacccgtgctgat
gtcaagggtggcacgctcatacaaatggagaacaagttgcgcctgctggaaatcgcccag
gtgcctccagagcatgtggatgactttaagtctgtcaagaccttcaagtttttcaatacc
aacaacatttgggccaatctgtcggctatcgaccgtgtgctgcgtgaacgcacgctcaac
atggagattattgtaaacaacaagacactggagaatggtctacgcgtcattcagctggag
acggcggtgggtgcggccatgaagtgtttcgatggcgccatcggcatcaatgtgccccgt
tcgcgtttcttgcccgtgaagaaatcgtctgatctgttgcttgtcatgtcgaatttgtat
acgcttaagaatggcagcctggtgatgtcgccgcagcgcatgttccccaccacgccgctt
gtgaaactgggcgagaatcatttctccaaggtcaaggagttcttgggtcgcttcgccaat
atacccgatattattgaactggatcatttgacggtcagcggcgatgtgacctttggtcgc
ggcgtctccttgcgcggcactgtgattattattgccaatcatggtgatcgtatcgatata
cccgctggcgccatactggagaacaaaattgtgtctggcaatatgcgcatcttggatcat
taa

DBGET integrated database retrieval system