KEGG   Drosophila virilis: Dvir_GJ12608Help
Entry
Dvir_GJ12608      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dvi  Drosophila virilis
Pathway
dvi00010  Glycolysis / Gluconeogenesis
dvi00562  Inositol phosphate metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ12608
   00562 Inositol phosphate metabolism
    Dvir_GJ12608
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dvir_GJ12608
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dvir_GJ12608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Methyltransf_14
Motif
Other DBs
NCBI-GeneID: 6623806
NCBI-ProteinID: XP_002046259
FlyBase: FBgn0199847
UniProt: B4LB37
Position
Unknown
AA seq 464 aa AA seqDB search
MRLLLLLLMALLAVVRAQQDYCFGKDTERLQTRQFSSKTAYQIVKGTNMDKQYQVPGCEP
KKMWIFHRHGTRLPTPSTIEAAPRLEEIRDLIVDNYRVRRTKPETDALCDTDLTAIQMWK
WNTSITVDIEEYLTSQGYEDLRGTAKLYQHYFPTVLPTTFNDTYYLFRHTDTQRTTESFK
GFAEGLFGDSNVATAADIPEKDLLLRPYDYCTDFKDKNYKGVGSEYQKYRTTAIWNNTVA
DITRRLGFTVLAEDDIKLMYDMCRYEQAWQVDRTSVWCGAFLPEHVTVMEYAEDLKYYYG
SGYGFEENTRFNCRAVQDMLSRLSSPVSPHVVAYFAHSTGLQTLLTALGINKDDIPLRAD
NYDSMTSRRWKTSLLGPFAGNFVAVKYDCPAELEKEKVVFFLNQNAVDLDWCNVGLCNWS
DVLEKYKTISEANCDEYYCRSGAPGGRASMLVTAFIAAFVYLMH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctgctgttgctgttgatggcccttctggccgtggttcgtgcccagcaggac
tattgcttcggcaaggacacggagcgactgcagacgcgtcagtttagctcgaagacagcc
tatcagattgtcaagggcaccaacatggacaagcagtatcaggtgcccggctgtgagccc
aagaaaatgtggatcttccacaggcacggcacacggctgcccacgccaagcaccattgag
gcggcaccgcgcctggaagagatacgtgatttgatagtggataattatcgagtgcgacgc
accaagcccgagactgatgccctgtgcgatacggatctgaccgccatccagatgtggaaa
tggaataccagcatcacagtggacattgaggagtatctgaccagccagggctatgaggat
ctgcgcggcactgccaagctctatcagcactactttcccacggtgctgcccaccacattc
aacgatacctactacctgttccgtcacacggacacacagcgtaccacggagagcttcaag
ggctttgccgagggtctctttggtgacagcaatgtggctactgccgcggatatacccgaa
aaggatctgctgctgcgtccctatgactattgcacggactttaaggacaagaactacaag
ggcgtgggctccgagtatcagaaatatcgcacaaccgccatatggaataatactgtcgcg
gatattacacgtcgacttggcttcacggttttggccgaggatgatatcaagctgatgtac
gacatgtgccgctacgagcaggcctggcaggtggatcggacgagcgtctggtgcggcgcc
ttcttgcccgagcatgtgaccgtcatggaatacgccgaggatctcaaatactactacggc
tccggctatggctttgaggagaatacacgcttcaattgccgcgccgtccaggacatgctc
tcccgcctgagcagtcccgtctcgccccatgtggtggcctatttcgcccactcgacgggt
ctgcagacgctgctcaccgcgctgggcatcaacaaggatgacatcccactgcgtgcggat
aactatgactcgatgacaagtcgtcgctggaagaccagtctgctgggtccctttgcgggc
aatttcgtggccgtgaaatacgattgcccggcggagctggagaaggagaaggtcgtcttc
ttcctcaaccagaatgccgtggacctagactggtgcaatgtgggtctctgcaactggtcg
gatgtgctggagaagtacaaaaccatctcggaggccaactgtgatgagtattattgccgc
tctggagcgcccggaggacgtgcctcaatgctggtcaccgcatttattgctgcatttgtc
tacttgatgcattag

DBGET integrated database retrieval system