KEGG   Drosophila virilis: Dvir_GJ13603Help
Entry
Dvir_GJ13603      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
dvi  Drosophila virilis
Pathway
dvi00071  Fatty acid degradation
dvi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dvir_GJ13603
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     Dvir_GJ13603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 6622348
NCBI-ProteinID: XP_002047742
FlyBase: FBgn0200825
UniProt: B4LE41
Position
Unknown
AA seq 675 aa AA seqDB search
MFKLKVHKSRFGAVLAATRNSTTTTTHGNHYQYLQNSKLPTLYFQRSLPRLPIPLLEKSC
ERFLAAVQPILSAEEHRETQQVVEQFRQGVGMELHAKLKQRDAANKHTSYISEPWFDMYL
TDRAPLPLNYNPLLVMRGDPRPEYQPQLTRATNLIISSLRFWRSLQANILEPEVYHMNPK
KTDTASYRRWMAIAPKAFATYASYAFKAFPLDMSQYSRLLGTTRIPKLGKDELVQSPHSK
HILVMRRGNMYAMNVLDSSGYILSPSVILGRLKSILEQDSQREPASVPLGVLTTAQRNDW
AQTRAHFISNPKNADLLQREVDAALFCLCLDSVEDGLFDEANPVPMLKHQLAGKATNRWF
DKSLSLLISADGVTAVNFEHSWGDGVAVLRYFNEVYKDMLQQPFVSAGTPHTPADGDTIN
VRPLNFEIDEKTRAAVEAAYAQNASIVESLDMNYLQYKQLNKGTCKRHGLSPDSIIQLAF
QLAYRQAFKRYVGTYESCSTSAFRHGRTETMRPCTMATKAFCEALLQPAQRQPSAGELRA
MIDKCSSVHGQLTKEAAMGQGFDRHLFALRHTAQLEGLPQPALFETEAYKRINYNIISTS
TLGTDTVVAGSFGPVVKDGLGVGYSIQNDFAGAIVTSYKNQAQGKEFIDSLESAFDQICA
IIERSNSAAKTEMSK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattaaaagtgcataagagccgctttggcgccgttctggctgcaacacgcaac
tctacaacaaccacaacacatggcaatcattatcaatacctgcagaactcgaagctgccc
acgctctattttcagcgctcccttccgcgtttgcccataccgctgctggaaaagtcgtgt
gaacgatttctggccgccgtgcagcccatacttagcgcagaggagcatcgggagacgcaa
caggtggtcgaacagtttcgccagggcgtcggcatggagctgcatgcgaagctgaagcaa
cgcgatgcggccaacaagcataccagctacatttcggagccctggttcgacatgtacctg
acggaccgtgcgcctctgccgctcaactacaatccgctgctggtcatgcgtggcgatccg
cggccagagtatcagccacagttgacgcgtgccacaaacttgatcatcagctcgcttcgt
ttctggcgctcgctgcaggctaatattctggagccagaggtctatcacatgaatcccaaa
aagacagacacggccagctatcgtcgctggatggccatcgcaccgaaagcctttgccaca
tacgcctcgtatgcattcaaggcctttccgctggatatgagccaatatagccgcctgctt
ggcaccacccgcataccgaagctcggcaaggacgagctggtgcagtcgccgcactcaaag
cacattcttgtcatgcgacgtggcaacatgtatgcaatgaatgtgctagacagcagcggt
tacattctaagcccgagcgtcatactgggtcgcctgaaaagcattcttgaacaggactcg
caacgggaaccggcaagcgtgccgctgggtgtgctcactaccgcccagcgcaatgactgg
gcccaaacgcgagcccacttcatcagcaatccgaagaacgccgatctgctgcagcgggag
gttgacgcagcactgttctgcctgtgcctggacagcgtagaggatggtctgtttgatgag
gccaacccggtgcccatgctaaagcatcagctggcgggcaaggcaacgaatcgctggttc
gacaagtcactgtcgctgttgatcagcgccgacggcgtcacggccgtcaactttgagcac
tcttggggcgatggcgtcgctgtgctccgttacttcaatgaggtctacaaggacatgttg
cagcagccgtttgtgtcggcaggcacgccgcatacaccagctgatggcgatactatcaat
gtgcgtccgctgaactttgagatcgacgagaagacacgtgcagctgtggaggcagcctat
gcacaaaatgccagcattgttgagagtctggatatgaattacttgcagtacaagcagctt
aataagggcacctgtaagcgacacggcctgagccccgactccatcatacagctagctttc
caactggcctatcgccaggcatttaagcgctatgtgggcacctacgagtcctgcagcacc
tcagcctttcgacacggtcgcaccgagaccatgcgcccctgcacaatggccaccaaagcc
ttttgtgaggctttgctacagccagcgcaaaggcagcccagcgccggggaactgcgcgcc
atgattgataagtgcagcagcgtgcacggccagctgaccaaggaggcggccatgggacag
ggctttgatcgtcatttgtttgccctaaggcatacggcacagctagaggggctgccgcaa
ccggcgctatttgagactgaggcttataaacgcatcaactataatattataagcacctcc
acgctgggcaccgatactgttgtagccggttcctttggccccgtggtcaaggatggactg
ggcgttggctactccattcagaacgattttgcgggcgccattgtgacctcgtacaagaac
caggctcaaggcaaggaatttatagatagcctggaatcggcattcgaccaaatatgcgcc
attattgagcgcagcaatagcgccgctaagaccgagatgagcaaataa

DBGET integrated database retrieval system