KEGG   Drosophila virilis: Dvir_GJ14779Help
Entry
Dvir_GJ14779      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dvi  Drosophila virilis
Pathway
dvi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ14779
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dvir_GJ14779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 6636055
NCBI-ProteinID: XP_002059519
FlyBase: FBgn0201983
UniProt: B4MEG6
Position
Unknown
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacatcgctgccaatggacatgtgctccaatttcgatgcagatgagatc
cgtcgcctgggcaaacgtttccgtaaactcgatctggacaattcgggagcgttgagcata
gatgagtttatgtcgctgccggaactgcaacagaatccgcttgtacagcgcgtcatcgat
atattcgatgcggatggcaatggtgaggtcgatttcaaggaattcatccagggcgtctca
cagttcagtgtgcgcggcgataagctatccaaattgcgtttcgcattccgcatctacgat
atggacaatgatggttatatctcaaacggtgagctctttcaggtgctcaaaatgatggtt
ggcaacaatttgaaggatacgcaactgcaacagattgtcgacaagacaatctgtttcgcc
gacaaggatgaggatggcaaaatatcattcgatgagttctgttccgtcgtgggcaatacg
gatatacataagaaaatggttgttgatgtttaa

DBGET integrated database retrieval system