KEGG   Drosophila virilis: Dvir_GJ14995Help
Entry
Dvir_GJ14995      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
dvi  Drosophila virilis
Pathway
dvi00052  Galactose metabolism
dvi00561  Glycerolipid metabolism
dvi00600  Sphingolipid metabolism
dvi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dvi01100  Metabolic pathways
dvi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dvir_GJ14995
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dvir_GJ14995
   00600 Sphingolipid metabolism
    Dvir_GJ14995
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dvir_GJ14995
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dvir_GJ14995
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dvir_GJ14995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 6636321
NCBI-ProteinID: XP_002059881
FlyBase: FBgn0202195
UniProt: B4MFP7
Position
Unknown
AA seq 419 aa AA seqDB search
MYSMLNIVAAFVFLLLQLLQGGTALDNGLALKPPMGWMSWQRFRCITDCKTYPDECISEQ
LFRRHADLIVSEGYADVGYEYVIIDDCWLEKNRDNKTNKLVPDRKRFPNGLNVLADHIHE
RGLKFGLYQDFGTNTCAGYPGVINHMALDAATFANWDVDYVKLDGCYANISDMAAGYPEF
GRLLNSTGRPMVYSCSWPAYQSEVGQMPEYESLKKHCNLWRNWDDIDDSLESLMQIIDYF
GKNQDSIQPHAGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAVLAAPLIMSNDLAKVRPE
IKDILQNRAVIAVNQDPLGIQGRRLLMKNNIEVWRRPITPTADAEYSYAVAFVSRRVDGA
PYAISFTLKDLSLNNEYGYGVQDLFEPNSNLGVFRSESHFNTRVIPNGVNFYKFTALGN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcatgttgaacattgtggccgcatttgtgttcttattgctgcagttgctccaa
ggtggtacagcgctggacaatggcctggcactcaagccacccatgggctggatgtcctgg
cagcgctttcgctgcataaccgactgcaaaacttatcccgacgaatgcataagcgagcag
ttgttccggcgtcacgcggatttaattgtctccgagggctatgctgatgttggctacgag
tatgtcatcattgacgattgttggctggagaagaatcgggataacaagacaaataaactt
gtgccggatcgcaagcgttttcccaatggcttgaacgtgctggccgatcatatacacgaa
cgaggactcaagtttggtttgtaccaggactttggcacaaatacgtgtgccggctatccg
ggcgtcatcaatcacatggcactcgacgcggcaacatttgccaattgggatgttgactat
gtcaagttggacggctgctatgcgaacataagcgacatggctgccggttatccagaattc
ggacgcctgcttaattcgacaggcaggcccatggtctactcctgcagctggcctgcgtat
cagtccgaagttggccaaatgcccgaatatgaatcgttgaagaaacactgcaatctgtgg
cgcaactgggatgatattgacgattcattggagtcgctcatgcagataattgattacttt
ggcaaaaatcaggacagcatacagccacatgctggaccaggacattggaacgatccggat
atgctgctgcttggcaattatggcttaagctatgatcaaagcaaattgcaaatggccatt
tgggctgtgctggcggcacccttgataatgtccaatgatttggccaaggtgcgaccagaa
atcaaggatatcctgcagaatcgtgccgtaattgctgtcaatcaggatccgctgggcata
cagggccgacgtttgctcatgaaaaacaatattgaggtctggcgtcgtcccataacaccg
acagccgatgccgaatactcttacgctgtggcttttgtcagccgtcgtgtggacggcgcg
ccatatgccatatcatttacgcttaaagatctgtcgctgaacaatgagtacggctacggt
gtccaggatttgtttgagccgaatagcaacttgggcgtttttcgatcggagagtcatttt
aatacacgcgttattcccaacggtgtcaacttctacaagtttacggcgctgggaaattga

DBGET integrated database retrieval system