KEGG   Drosophila virilis: Dvir_GJ16355Help
Entry
Dvir_GJ16355      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dvi  Drosophila virilis
Pathway
dvi03040  Spliceosome
dvi04141  Protein processing in endoplasmic reticulum
dvi04144  Endocytosis
dvi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dvir_GJ16355
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dvir_GJ16355
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dvir_GJ16355
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dvir_GJ16355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dvi01009]
    Dvir_GJ16355
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dvi03041]
    Dvir_GJ16355
   03009 Ribosome biogenesis [BR:dvi03009]
    Dvir_GJ16355
   03110 Chaperones and folding catalysts [BR:dvi03110]
    Dvir_GJ16355
   04131 Membrane trafficking [BR:dvi04131]
    Dvir_GJ16355
   03051 Proteasome [BR:dvi03051]
    Dvir_GJ16355
   03029 Mitochondrial biogenesis [BR:dvi03029]
    Dvir_GJ16355
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvi04147]
    Dvir_GJ16355
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dvir_GJ16355
Spliceosome [BR:dvi03041]
 Complex B
  Other components
   Prp19 complex
    Dvir_GJ16355
 Complex C
   Prp19-CDC5 complex
    Dvir_GJ16355
Ribosome biogenesis [BR:dvi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dvir_GJ16355
Chaperones and folding catalysts [BR:dvi03110]
 Heat shock proteins
  HSP70 / DNAK
   Dvir_GJ16355
Membrane trafficking [BR:dvi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dvir_GJ16355
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dvir_GJ16355
Proteasome [BR:dvi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dvir_GJ16355
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dvir_GJ16355
Exosome [BR:dvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dvir_GJ16355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA FGGY_C Hydantoinase_A Zincin_2 DUF4795
Motif
Other DBs
NCBI-GeneID: 6637075
NCBI-ProteinID: XP_002060490
FlyBase: FBgn0203539
UniProt: B4MH86
Position
Unknown
AA seq 584 aa AA seqDB search
MNPKNTVFDAKRLIGRRYDDPKIAEDIKHWPFKVVSDGGKPKIGVEFKGEQKRFAPEEIS
SMVLVKMKETAEAYLGQSITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAA
LAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVT
HLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEVDALFEGHDFYTKVSR
ARFEELCADLFRNTLAPVEKALNDAKMDKQQIHDIVLVGGSTRIPKVQSLLQQFFGGKSL
NLSINPDEAVAYGAAVQAAILSGDQSGKIQDVLLVDVAPLSLGIETAGGVMTKLIERNSR
IPCKQTKTFSTYSDNQPGVSIQVYEGERALTQHNNSLGTFDLSGIPPAPRGVPQIEVTFD
MDANGILNVTAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNEAERYADEDEKHRERITAR
NSLESYVFGVKQAVEQASPDKLSDSDKSSVLDKCSETVKWLDANTTADKEEFEYKLKELT
QHCSPIMTKLHQQGQPQGNANCGQQAGGFGGAGGYQGPTVEEVD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaagaacacagtattcgatgcgaagcgtctgattggtcgcaggtacgatgat
ccgaagatagcggaggacatcaagcactggcccttcaaggtggtcagcgacggaggcaag
cccaagattggcgtcgagtttaagggggagcagaagcgttttgcgcccgaggagattagc
tcgatggtgctggtgaagatgaaggaaacggcggaggcgtacctgggccaaagcatcaca
gacgcggtcatcacagtgcccgcctatttcaacgactcgcagcgccaggctaccaaagat
gccggccacatagccggactgaacgtgctgaggatcatcaacgagccgacggcggcggca
ctggcctatggcctggacaagaatctgaagggcgaacgcaatgttttgatcttcgatctg
ggcggcggcacctttgatgtctccattctaaccatcgacgagggctcactgttcgaggtg
cggtcaacggctggagacacacatttgggcggcgaggactttgacaacagactggtaacc
catctggcggaggagtttaagcgcaagtacaagaaggatctgcgctccaatcctcgcgcc
ctgcgccgcctgcgcactgcggcggagcgagccaagcgcacgctctcgtcgagcacagaa
gctaccattgaggtggacgcgctgttcgagggccacgacttctacacgaaggtgagccgt
gcccggttcgaggagctgtgcgccgatctgttccgcaacacactggcgccagtggagaag
gcgctcaacgatgccaagatggacaagcagcagatccacgatattgtgctcgtcggtggc
tcgacacgcattcccaaggtgcagagcctgcttcagcagttcttcggcggcaagagcctc
aacctttccatcaatcccgacgaggcggtggcctatggcgccgcagtccaagcagccata
cttagcggcgaccagagcggcaagatccaggacgtgctcctggtggacgttgcgcccctt
tcgttgggcatcgagactgccggcggcgtcatgaccaagctgattgaacgcaactcccgg
atcccgtgcaagcagacgaagaccttctcaacgtactctgacaaccagccgggcgtctcc
attcaggtgtacgagggcgagcgcgccctcacgcagcacaacaattcgctgggcacgttc
gatttgtctggcataccgccggcaccgcgcggcgtgccccaaatcgaggtcaccttcgac
atggacgccaatggtatcctgaacgtgacggccaaggagatgagcaccggcaaggccaag
aacattaccatcaagaacgacaagggccgcctctcgcaggcagagatcgaccgcatggtg
aacgaggccgagcgctacgcggacgaggatgagaagcaccgagagcgcatcacggctcgc
aacagcctcgagagctacgtcttcggcgtcaagcaggccgtggagcaggccagtcctgac
aagctgagtgacagcgataagtcctccgtgctggacaagtgcagcgagaccgtcaagtgg
ctcgacgccaacaccacagccgacaaggaggagttcgagtacaaactaaaagagctcacc
cagcactgctctcccatcatgaccaagctccaccagcagggacagcctcaaggaaacgcc
aactgtggtcagcaggcgggcggctttggtggtgccggtggctaccaaggacccaccgtg
gaggaagtcgattaa

DBGET integrated database retrieval system