KEGG   Drosophila virilis: Dvir_GJ16583Help
Entry
Dvir_GJ16583      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase
Motif
Other DBs
NCBI-GeneID: 6633689
NCBI-ProteinID: XP_002057006
FlyBase: FBgn0203767
UniProt: B4M6S5
Position
Unknown
AA seq 947 aa AA seqDB search
MSYANFTELSEAVHASLLAHEQLQRQRQLLHGRAKRAVKRVCYGELGCFEDSGPFAYLEM
LPSSPEEINTKFYFYSTRQRSDRPLMELSFLNMTAAFAKAKAKAKRESETPTPPVTTSAP
AGTASAPGLNVTTDKPNVMGGSPKKPPPPSIDDLEGFDELSVRVIVHGFGSACPHVWIYE
MKTALMAVEDCIVICVDWENGATFPNYVRAAANTRLVGKQLAMLLQHLQQHKGLNLMRTH
VIGFSLGAHVSGFAGAELPGLSRITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGEN
LILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRA
YKFFIDSVAPRCMFPAFPCANYDDFLKGKCFPCAQDDEDLAEGVPRCGNMGYYADRSTGR
GQLYLLTREEEPFCAHQFQLQIFNSFNDLPLRTIGRLEAILEGDGGLNETFEISEKDDAE
FFAGDIVSKIIVPHPALGFPTTLSLHYKSYSGWLSKGLPHWDIDKVVLTDSFGRSHSLCR
PSTKLSSGSPVRMRLQAGNCELDNQDDYGAYTTQPPAGLPSSTDAPESDSSGQASGLSAS
VDGVESVKQRKDIFNLGTSFKLAQNQTYPLDQTDELPWQPILVGNSLDKDNTEAEPAESS
RSLSDALAPGEQPINEIFEPVLKDRRLAVNRGRNLHDPANTSEIVEPVLKATTPRAKQGK
DLQLAEPVDGNVNASSTDTPALATPPKMMAQLSSGAEEPQTVQLLPFRLGELLQRAERYA
RETLLPLISVQAPRFFGFNVTPHDRELARPGESRKPRYIPRYEEAAFLNSNSNSNSSSSG
QQRRSSDSLESTDQAARRNLFRLLRSNGARGRAAQQRRAAPLSIREPDQNDFNYYTNMLH
TESRSMRPEAPEYRPVFVELPTYRPPVAGQIKATAKGQRRARLQRSP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgccaactttacggaactctccgaggcggtgcatgcctcactgctggcgcat
gagcagctgcagcggcagcgccaactgttgcacggacgggccaagcgggcggtgaagcgc
gtctgctacggggagctgggctgctttgaggactccggtccgtttgcctatttagagatg
ctgccctcatcacccgaggagatcaataccaagttctatttttactcgacacgtcaacgc
tcggatcggccgctcatggagctgtcatttctcaatatgactgcggcgtttgccaaggct
aaggccaaggccaagcgcgaatctgagacgccaacgccgccggtcacaaccagcgcgcca
gcgggcacagcttctgcgcctggcttgaatgtgaccaccgacaaaccgaatgtcatgggc
ggcagtccaaagaagccgccgccgccatctatcgatgatctggagggcttcgacgaactt
tctgtgcgcgtgattgtgcacggctttggctccgcctgtccgcacgtatggatctatgag
atgaaaacagctttgatggcagtggaggattgcattgtcatctgcgtggactgggagaat
ggcgctacctttcccaattatgtgcgcgccgcggcgaatacgcgtctggtgggaaagcag
ttggccatgttgctgcagcatctgcagcagcacaagggtctgaatctgatgcgcacccac
gtgattggcttcagcctgggggcgcatgtctctggatttgcgggcgccgagctgcctggc
ttgtcgcgcataaccggcttggatccggctgggccgctattcgaggcgcagcatccgaag
gtgcggctggacagcagcgatgcggaattcgtggatgtcatacactcgaacggcgagaat
ctaatattgggcggcctgggctcctggcagcccatgggccatgtcgactactatccgaac
ggcgggcgcgtccagacgggctgctctaatctgtttgtaggcgccgttacggacttcatc
tggtctgcccaggcggcggaggatgaggaggggcgttcgctgtgcaatcatcggcgcgcc
tataagttctttattgattcggtggcgccgcgctgcatgtttcccgcctttccgtgcgcc
aactacgatgattttctcaagggcaagtgcttcccctgcgcccaggacgatgaggatctg
gccgagggtgtgccacgctgcggcaacatgggctactatgcggatagatcgaccggccgg
ggtcagctctatctgctgacgcgcgaggaggagcccttctgtgctcatcaattccaatta
caaatcttcaactcgttcaacgatctgccactgcgcaccattggccgcctcgaggccata
ctcgagggcgatggcggcctcaacgagaccttcgaaatatccgaaaaggacgatgcggag
ttctttgccggcgacattgtgtccaaaattattgtgccacatccagcgctgggctttccc
accacgcttagcctgcactataagtcatacagcggctggctgtcgaagggcctgccccac
tgggacattgataaggtggtgctgacggacagctttggacgcagccactcgctctgccgg
cccagcaccaagctaagcagcggcagtcccgtgcgcatgcgtctgcaggcgggcaactgt
gagctggacaatcaggatgactatggcgcctatactactcagccgccggctggattaccg
tcgagcacggacgcacccgagtcggactccagtgggcaggcgtccggtctgagcgccagc
gttgatggggtcgagagtgtgaaacagcgcaaggatatattcaatttgggcaccagcttt
aagcttgcacagaatcaaacctatccgctggaccaaacggatgagctgccctggcagccc
atactggttggcaattccctcgacaaggacaacaccgaagcggagccggccgagtccagt
cgcagtctgtccgatgctttggcgcccggcgaacagccgatcaacgagatattcgagccg
gtgctcaaggatcgacggttggctgtcaatcgtggacgcaatctacacgatccggccaac
acgtccgagattgtggagccggtgctcaaggcgaccacaccgcgcgccaaacagggcaag
gatctgcagctggccgaaccagtggatggcaatgtcaacgccagctccacggacactccc
gctctggccacgccgcccaaaatgatggcacagctctccagcggtgcagaggagccgcaa
acggtgcagttgctgccgttccggctgggtgagctgctgcagcgcgccgagcgctacgca
agggaaactctgctgccgctcatatctgtgcaggcgccgcgcttctttggcttcaatgtg
acgccacacgatcgtgaactggcccgacccggcgaatcccgtaaacctcgctacatacca
cgctacgaggaggcagcctttctcaacagcaacagcaacagcaacagcagcagcagcgga
cagcagcgccgcagctcggattcgttagagtcaacggatcaggcggcacgccgcaatctc
ttccgtttgctgcgctcgaatggggcacgcggtcgtgccgcccagcagcggcgggcggct
ccgttgtccatccgggagccagaccaaaacgacttcaactattacacgaatatgctgcac
acggagtcgcgttcgatgcgacccgaggcacccgagtatcggcccgttttcgttgagctg
cccacatatcggccgcctgtcgccggccagataaaggccacggcaaagggtcagcggcgt
gcacgcctgcagcgaagtccctga

DBGET integrated database retrieval system