KEGG   Drosophila virilis: Dvir_GJ16722Help
Entry
Dvir_GJ16722      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08738  cytochrome c
Organism
dvi  Drosophila virilis
Pathway
dvi04214  Apoptosis - fly
dvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dvir_GJ16722
   04215 Apoptosis - multiple species
    Dvir_GJ16722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 6628446
NCBI-ProteinID: XP_002051649
FlyBase: FBgn0203903
UniProt: B4LSR5
Position
Unknown
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAPGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgctgcgca
cagtgccacaccgtcgaggccggtggcaagcacaaggtgggccccaatctgcacggtctg
atcggtcgcaagaccggccaggcgcccggcttcgcgtacacagacgccaacaaggccaag
ggcatcacctggaacgaggacacactcttcgaatatctggagaaccccaagaagtatatc
cccggcaccaagatgatcttcgccggcctgaagaagcccaatgagcgtggtgatctgatc
gcttacctgaaatcggctaccaagtaa

DBGET integrated database retrieval system