KEGG   Drosophila virilis: Dvir_GJ17066Help
Entry
Dvir_GJ17066      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
dvi  Drosophila virilis
Pathway
dvi00830  Retinol metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ17066
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     Dvir_GJ17066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF2456 DUF543
Motif
Other DBs
NCBI-GeneID: 6633305
NCBI-ProteinID: XP_002057404
FlyBase: FBgn0204243
UniProt: B4M7X3
Position
Unknown
AA seq 358 aa AA seqDB search
MEKLNTTVGHPMPLTFDLGICLEDFWLQCALALLIGVAMGLVLWLVRMFILGPMYRKPNR
IDGKVVIVTGCNTGIGKETVLELARRGAKIYMACRDPVRCEAARIEIMDRTQNQQLFNRS
LDLGSLESVRNFVARFKAEETRLDILINNAGVMACPRTLTADGYEQQLGVNHLGHFLLTY
LLLDRLKQAAPSRIVVVTSLAHLFGRINREDLMGERNYRSLLGAYTQSKLANVMFTRKLA
MMLMGTGVTVNCCHPGLVRTDLYRHFVAPRWFLNTLSVLSLYFFKTPRAGAQTQLYLALD
PALANCTGCLYADCVRCPLVPRARDVATTDWLWRESEKLVGLSPAKRHATNITMWSDA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgaataccacagttggccacccaatgccgttaacattcgacctgggcatc
tgccttgaagacttctggctgcaatgtgcattggccctgctcatcggagtggccatgggg
ttagtattgtggctagtgcgtatgtttatcctgggtccgatgtaccgcaaaccgaaccga
atcgatggcaaggtggtcatcgtcaccggctgcaacacgggcattggcaaggagacggtg
ctggagctggcgcgccggggcgccaagatctacatggcctgccgggatccggtacgctgc
gaggcagcccgcatcgagatcatggatcgcactcagaaccagcagctgttcaatcgcagc
ttggatctcggctcgctggagtcggtgcgcaactttgtggcacgcttcaaggccgaggag
acgcgcctcgatatcctgatcaacaatgccggcgtcatggcctgtccgcgtactctcacc
gccgacggctatgagcagcagttgggcgtcaatcatttgggtcactttttgcttacttat
ctgctgctggatcggctcaagcaggcggcgcccagccgcattgtggtggtcacctcgttg
gcgcatctcttcgggcgcatcaaccgcgaggatctgatgggcgagcgcaattatcgcagc
ctgttgggcgcctacacccagtccaagctggccaatgtgatgttcacgcgaaagctggcc
atgatgctgatgggcacgggcgttacggtcaattgctgccatccgggcctggtgcgcacg
gatctctatcggcactttgtcgctccgcgctggttcctgaacacccttagtgtgctctca
ctttatttctttaagacgccgcgtgccggggcccagactcagctatatttggccctggat
ccggcattggccaattgcacgggttgcctatacgcggactgtgttcgctgtccgctcgtg
cccagggcacgtgacgtggccaccaccgactggctctggcgcgagagcgagaagcttgtg
ggcttgagcccagcaaaacggcatgcaaccaacattacaatgtggtccgacgcctaa

DBGET integrated database retrieval system