KEGG   Drosophila virilis: Dvir_GJ17463Help
Entry
Dvir_GJ17463      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
dvi  Drosophila virilis
Pathway
dvi00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dvi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    Dvir_GJ17463
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dvir_GJ17463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dvi01003]
    Dvir_GJ17463
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     Dvir_GJ17463
Glycosyltransferases [BR:dvi01003]
 Glycan extension
  P blood group
   Dvir_GJ17463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 6627856
NCBI-ProteinID: XP_002052275
FlyBase: FBgn0204635
UniProt: B4LVN6
Position
Unknown
AA seq 392 aa AA seqDB search
MLLRLPLLLSRFLHNGRLRLLFLALIVLLLGGILLNYRWQSDVQLCFIEREQTESASSGP
LTDAAVPVPKILEDVLSTDPKPIPGRSIFFHETSCHRPKRRRQRHGQSPDLQYNMLQLTA
RQACAIESAALHNPNFQVFVLFAGPTYRHLSNSSQRQQPIIDAILSYKNVQLRQLNLWRY
AAGTPIEEWLKDGRLFRSSYLFSHISDFLRFLTLYRYGGIYLDMDVVMLRSMEDVPPNFT
GAESNTHLAAGVMSLAPTGFGHEIAESCLRDFQLHFDGSDWGNNGPGVITRVAQQICGTQ
DISLMLEDRKRCLGFKVFDRNAFYAVPWKHWRHFFEPQLLEQTLEHTKDSYLVHVWNKHS
KQLAIKVGSSTAYGKYAEQHCPKAYAAAGEYF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttactacgcttgccgctgttgttatcgcgttttctgcacaatggacggctgcggctg
ctattcctagcgctaattgtcctgcttttaggcggcatactcttaaattatagatggcag
tcggatgtgcaactttgttttattgagagggagcaaacagagtcggcttccagtggccct
ttgacggacgctgctgtgcctgttccaaagattttggaagatgtgctgtcaacagatccc
aagccaatacctggccgtagcatattctttcatgaaacaagttgtcacagaccaaaacga
agaagacagcgtcatggccaaagtcctgatttacagtacaacatgttgcagttaacggcg
cgccaggcatgtgccattgaatctgccgcattgcataatccgaattttcaagtgtttgtg
ctgttcgctggtcccacctatcgacacctcagcaacagcagccaacgccagcagccgatc
atcgatgccattctaagctacaaaaatgtgcagcttcgacagttaaatctttggcgctat
gcggccggcacgcctattgaggagtggctaaaggatggacgcttgtttcggtcaagctat
cttttctcgcatatatcagattttttaagatttctaacgctttatcgctatggcggtatt
tatttggacatggatgtagtaatgctacgcagcatggaggatgtgccgccaaattttacg
ggcgccgagtccaatacacatttggccgctggcgtaatgagtctagcccccactggtttt
ggtcatgagattgccgagtcttgcctgcgtgattttcagctgcatttcgacggtagtgac
tggggcaacaatgggcctggggttataacgcgtgtggcacaacagatttgtggcacacaa
gatatctcactgatgctggaagatcggaaacgctgccttggcttcaaggtattcgatcgc
aatgcgttttatgctgtaccctggaagcattggcggcatttcttcgagccccagctgctc
gagcagactctggaacacacgaaggactcatacttggtgcacgtgtggaacaagcactcc
aaacagctggccatcaaggtcggatcgagtaccgcctacggcaagtatgcggagcagcat
tgtcccaaggcgtatgcagcagcgggtgaatatttctaa

DBGET integrated database retrieval system