KEGG   Drosophila virilis: Dvir_GJ17729Help
Entry
Dvir_GJ17729      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K18826  calmodulin-lysine N-methyltransferase [EC:2.1.1.60]
Organism
dvi  Drosophila virilis
Pathway
dvi00310  Lysine degradation
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dvir_GJ17729
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.60  calmodulin-lysine N-methyltransferase
     Dvir_GJ17729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_16 MTS Methyltransf_25 Methyltransf_23 Menin
Motif
Other DBs
NCBI-GeneID: 6628931
NCBI-ProteinID: XP_002052747
FlyBase: FBgn0204898
UniProt: B4LT60
Position
Unknown
AA seq 443 aa AA seqDB search
MSANLVQKKTNKITKLNSSNLEQVQSTRSNDGVGVAGGKHIASISQMLQYDIDNTLNALK
EQQRNALMEQATTNNNNNNNNNNRNRNSDKNSDRENNLEMPAQSPSIAVSPSLELEVENI
VTGKSCLGVANAFMPPTPPATPNLQNTAQKRWRILAKVLRKDSEETVSSSSDEFGEEQTA
SVRRFKSFDLLRQDSFEDHVSLKCLGKTENWYKYRMQLHNDIEYSVNIHHMDRQLTASDL
MGFNNTGNICVWPSEEALTALVLSDLAAYRGKWILELGGGFTSLAGLMLAKYAKPYAVHL
TDGNEVSVENVRKTVCLNELSCYTKCSVLKWQEAAARAAAEQSKFEFILCADCLFFDEAR
SALVDTIWYYLAPQGVALIMAPRRGRTLNVFRDECVARGFRVDLATRYNETIWQRHLQLK
ADSALYDEDLHYPLLLRLCKSHS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaatttagtacaaaagaaaacaaacaaaataacgaaactgaacagcagcaat
ttggagcaggtgcagtcaacgaggtcaaacgacggcgtgggcgtggcaggtggaaaacat
attgccagcatatcgcagatgctgcaatacgatattgataatacgctgaatgcgctcaag
gagcaacagcggaatgcgctaatggaacaggcaaccacaaacaacaacaacaacaacaac
aacaacaacaggaacaggaatagtgacaagaactctgaccgggagaacaatttggagatg
cccgcacaaagccccagcatagctgtcagtcccagcctcgagctggaggtggagaacatt
gtgacgggcaaatcgtgtttgggcgttgcgaacgcctttatgccgcccacgccgccagcc
acgcccaatttacaaaatacggcacagaagcgttggcgcattctggcgaaggtgttgcgc
aaggattccgaggagacggtcagctcctccagcgatgagtttggcgaggagcaaaccgcc
tctgtgcgccgtttcaagagcttcgatctgttgcgccaggacagcttcgaggatcatgtt
agcctgaagtgcctgggcaagacggagaactggtacaaatatcgcatgcagctgcacaac
gacatcgagtactcggtgaatatacatcatatggaccgacagctgacggccagcgatctg
atgggcttcaataatacgggcaacatatgcgtctggccgtcggaggaggcgctcaccgcg
ctggtgctatccgatctggccgcatatcgcggcaagtggatactcgagctgggcggcggc
tttacctcgctggcgggcctgatgctggccaaatatgccaagccctatgcggtgcatctg
accgatggaaacgaggtgagcgtcgagaatgtccgcaaaactgtttgcctcaacgagctg
agctgctacaccaaatgctccgtgctcaagtggcaggaggcagcggcacgtgccgccgcc
gaacagtccaagtttgagttcatattgtgtgcggactgtctgttcttcgatgaggccaga
tcggcgctggtcgataccatctggtattatttggcgccgcagggcgtggccctcatcatg
gcgccccgtcgcggtcgcaccctgaacgtgtttcgcgacgagtgtgtggcgcgtggcttt
cgcgttgaccttgccacacgctacaacgagaccatctggcagcgtcatctgcagctcaag
gcggactcggcgctctacgacgaggatctccactatcctctcctgttgcgcctctgcaag
tcgcacagctag

DBGET integrated database retrieval system