KEGG   Drosophila virilis: Dvir_GJ17764Help
Entry
Dvir_GJ17764      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dvi  Drosophila virilis
Pathway
dvi00040  Pentose and glucuronate interconversions
dvi00053  Ascorbate and aldarate metabolism
dvi00830  Retinol metabolism
dvi00860  Porphyrin and chlorophyll metabolism
dvi00980  Metabolism of xenobiotics by cytochrome P450
dvi00982  Drug metabolism - cytochrome P450
dvi00983  Drug metabolism - other enzymes
dvi01100  Metabolic pathways
Module
dvi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ17764
   00053 Ascorbate and aldarate metabolism
    Dvir_GJ17764
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ17764
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ17764
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dvir_GJ17764
   00982 Drug metabolism - cytochrome P450
    Dvir_GJ17764
   00983 Drug metabolism - other enzymes
    Dvir_GJ17764
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dvir_GJ17764
Glycosyltransferases [BR:dvi01003]
 Others
  Hydrophobic molecule
   Dvir_GJ17764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 6628652
NCBI-ProteinID: XP_002052807
FlyBase: FBgn0204933
UniProt: B4LTC0
Position
Unknown
AA seq 529 aa AA seqDB search
MQLQSSSLLWFGVLAVCGLSANAYRILFMGPFPAPSHWMWLEHFQRNLLQRGHQVTSLNN
HPTKTPHENLTEIILNPIFDIPKHFPKKNIFSMRFASDFQNLELWWQIGQMTTEHALQDA
QVRRLIDSQDEHFDVVILEQFFHEAFLMFGHKFKCPVITIGTMGYADNMDHAMGILTPWS
VIPHLLLPHTDQMTFVQRAYNTYLSLYDAIMRRWYYLPRMQQLAEKYFGAAIKGELPHVH
DLERNISLMLINSHRSIDLPRPSMPGLVNVGGAHIQPAKKLPTEMQSFMDNATHGVVYFS
LGSYMKSTDMPPEKTAQLLQAFGKLKQQVLWKYENASIGQLPDNVMIRKWMPQNDILAHP
NVKVFITHGGIFGTQEGIYWGVPMLCIPLYGDQHRNTIKSVREGYARSLVFSQLTVDDLV
HNIEALIYEPQYKRSALEVSQRFRDNPIHPLEEASYWIEYIIRHRGARHLKSQGAFMPLY
QYLLLDVIGCVLIALWLTIWLPWRLLRKLNKWWAASAATAQAQQIKKGL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaatcgagctctttactctggttcggagtactggccgtatgtggactgagc
gccaatgcatatcgtatactatttatggggccctttccggcgcccagtcactggatgtgg
ctggagcatttccagcgcaacctgcttcaacgtggacatcaggtgacaagtctcaataat
catcccacaaagacgccgcatgagaatctaactgagataatactcaatcccatcttcgac
atacccaagcactttcccaagaagaacatcttcagcatgcgcttcgccagcgattttcag
aatctggaattgtggtggcaaattgggcagatgaccacggagcatgctctgcaggatgcg
caggtgaggcgactgatcgatagccaagacgaacacttcgatgtggtcatattggagcag
ttcttccacgaagcattcctcatgtttggccacaagttcaagtgtccggtgatcaccatt
ggcaccatgggctacgcggacaacatggaccatgccatgggcatactgacgccctggtcg
gtcataccccacctgctgctgccgcatacggatcagatgacattcgtgcaacgagcctac
aacacgtacttgtccctgtacgatgcaatcatgaggcgttggtactacttgccacgcatg
cagcagctggcggaaaagtattttggagcagccatcaaaggtgaactgccccatgtgcat
gatttggagcgcaacatctcgctgatgctcatcaacagccatcgcagcatcgatctgcca
cgccccagcatgccgggtcttgtcaatgtgggcggcgcgcatattcagcccgccaagaag
ctgccaaccgaaatgcaaagctttatggacaatgccacacatggtgtggtctacttcagt
ctgggctcgtatatgaaaagcacggatatgccgccggagaaaacggcccagttactgcag
gcctttggcaagctcaagcagcaggtgctgtggaaatatgagaacgcctcgattggtcag
ttgcctgacaatgtgatgatacgcaagtggatgccacagaatgacattttggcccatccg
aatgtcaaggtttttatcactcacggtggcatctttggcacccaggagggtatctattgg
ggcgtgcccatgctgtgcattccactgtatggcgatcagcacaggaatacaataaagtcc
gtgcgtgagggctatgcccgtagcctagtcttctcccagttgacagtcgacgacctggtg
cataatattgaggctctgatctatgagccgcagtacaagcgcagtgccttggaggtatca
caacgtttccgtgataatccaatacatccgctggaggaggccagctactggattgagtac
atcatccggcatcgtggcgcgcgtcatttgaaatcacagggtgccttcatgccgctctat
cagtatctgctgctcgatgtgattggctgtgtgctgatcgccctgtggctgactatctgg
ctgccttggcgcctactccgcaagctaaacaaatggtgggcagcgtcagcagcgactgcc
caggcgcaacagatcaaaaaaggtttgtga

DBGET integrated database retrieval system