KEGG   Drosophila virilis: Dvir_GJ18086Help
Entry
Dvir_GJ18086      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
dvi  Drosophila virilis
Pathway
dvi00970  Aminoacyl-tRNA biosynthesis
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dvir_GJ18086
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dvi03029]
    Dvir_GJ18086
Enzymes [BR:dvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dvir_GJ18086
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dvir_GJ18086
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dvir_GJ18086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln GBP T3SS_LEE_assoc
Motif
Other DBs
NCBI-GeneID: 6634343
NCBI-ProteinID: XP_002057471
FlyBase: FBgn0205251
UniProt: B4M8L8
Position
Unknown
AA seq 157 aa AA seqDB search
MLRISARFYCKIATQSSFKAAEYKNKIKKDKKLNFTQLLHPTKVPQTPVPAAFSDPSENV
VEIDTKTIQLLERLSLVDLDSDQALATLKSSIQFADKIAHIDTQNVRPLYTVLEKQQLQL
RNDQVTAGDSRAELLRCAKVTDEDYYVSPPGNIPLEQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaatttctgctcggttttattgcaaaattgccactcaatccagttttaaagcg
gccgagtacaagaacaaaataaaaaaagataaaaaactgaattttacgcagcttttgcat
ccgacaaaggtgccacagacgcccgtaccggcggctttttcggacccctccgaaaacgtc
gtcgaaatagataccaaaacaattcaattgctagagcgtttatccttggtggatctggac
agtgaccaggcgctggccacgctcaaaagcagtatacaatttgcagataaaatagcgcac
atagatacgcaaaacgtccgcccactgtacacggtactagagaaacagcagctgcagtta
cgcaacgaccaggttacagcgggcgatagccgagcagagctgctgcgttgcgccaaggtg
acagacgaggattactacgtgtcaccgccgggcaacataccgctggagcaataa

DBGET integrated database retrieval system