KEGG   Drosophila virilis: Dvir_GJ18167Help
Entry
Dvir_GJ18167      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
dvi  Drosophila virilis
Pathway
dvi00061  Fatty acid biosynthesis
dvi00071  Fatty acid degradation
dvi01100  Metabolic pathways
dvi01212  Fatty acid metabolism
Module
dvi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dvir_GJ18167
   00071 Fatty acid degradation
    Dvir_GJ18167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dvi01004]
    Dvir_GJ18167
Enzymes [BR:dvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Dvir_GJ18167
Lipid biosynthesis proteins [BR:dvi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Dvir_GJ18167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding DUF5460
Motif
Other DBs
NCBI-GeneID: 6634051
NCBI-ProteinID: XP_002057504
FlyBase: FBgn0205332
UniProt: B4M8Q1
Position
Unknown
AA seq 682 aa AA seqDB search
MERDEKLRPATSYTSTSLHEAVKLRRDEKDTIGVQSVPEFFREACQKYAQLPALVWEQSA
EQQDWITLSYADYEKRVEQAALMMLHVGLEERSSLAVLAFNCPEWFFAELGALRAGGVVA
GIYPSNSAEACYHALVTSDATVCVVDDDKQMAKLRAIKHRLPRLKAVIQLHGPYESFVNQ
EPDYFSWQQLTQTLETLDTDQLQQELERRERGIYANDCAMLIFTSGTVGMPKAVMLTHDS
VVYDTKIVSATMENTVLGAERLVSYLPLSHIAAQIFDIFVAMSHGGCVYFADKDALKGTL
VRSFLKAKPTRMFGVPRVFEKFQERLVAAEAKAKPYSRLLLSKAREVVAQHQLAIIAGEK
VSLYAQAKYWLATLIVRPIRQMLGLELCKSFLTGGAPVSPELKQFFLGLDMPLADVYGMS
ETGGAITLNESITNLYSSGAPILGTEVKIDKPDVNGQGEILMRGRNNFMGYLGEPAKTEE
AITPDGWLHSGDVGYLDTHGNVVISGRLKELIITAGGENIPPVHIEELIKHELPCVSNAL
LVGDHRKYLTVLLALKTKSDASTGLPLDQLREETIEWLNELGLQQTLLSELLNIPADLQL
PSDANALAAALEINAEPKLLEALEAGIKRANKNAISKAQCVQKFALLPHEFTLATGELGP
TLKIRRNIVHTKYGPLIDRLYK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgacgagaagctgagaccagcgacaagctatacgagcacctcactgcatgag
gctgtcaaactgcgacgggacgagaaggatacgatcggagtgcagagtgtgccggaattt
tttcgcgaggcctgccagaaatacgctcaactacctgccctggtctgggagcaatctgcg
gaacagcaggattggataacgctcagctatgcggattacgagaagcgggtggagcaggcg
gcgctaatgatgttgcatgtagggctggaggagcgcagctcattggccgtactcgccttc
aattgcccggaatggttttttgccgaattgggcgccctgcgcgccggcggcgttgtggct
ggcatatatcccagcaattccgcggaggcctgttaccatgcgctggtaaccagcgatgca
acagtctgtgtggtggatgatgacaagcaaatggccaagctgagagcgatcaagcatagg
ctgcccaggttgaaggctgtcatccagctacacggaccgtacgagagctttgtcaaccag
gagccggactactttagctggcagcaactgacgcaaacgctggaaacgctcgacaccgat
caactgcagcaggagctggagcgacgcgagcgtggcatctatgcaaatgactgcgccatg
ttgatcttcacatccggaacggtgggcatgcccaaggctgtaatgcttacccatgatagt
gttgtctacgacacgaaaattgtgtccgccaccatggaaaataccgtattgggcgccgag
cgtttggtcagctatttgccattgagtcacattgccgctcaaatctttgacatctttgtg
gctatgtcgcatggcggctgtgtttactttgcggataaggatgcgctcaagggcacactg
gtgcgcagcttcctaaaggccaaaccgacgcgcatgttcggtgtgccgcgtgtctttgag
aagttccaggagcgtcttgtggccgccgaggccaaggccaaaccctattcccgcctgctg
ttgtccaaggcgcgcgaggtggttgcccagcatcagctggccataattgctggcgagaaa
gtctctttatacgcccaggccaagtactggctggccacccttatcgttcgacccatacgc
cagatgctgggcctggagctttgcaagtctttcttaacgggcggcgcacctgtctccccg
gaactcaagcaattctttttgggcctggacatgccgctagccgatgtctacggcatgtca
gagacgggcggcgccattacgttgaacgagagcatcacaaatctctatagctcaggcgca
ccgatcctgggcacagaggtcaagatagacaagccggatgtgaatggccagggcgagatc
cttatgcgtggacgcaataatttcatgggctatctgggtgagccggctaagacggaggag
gccatcacgccggatggctggctgcacagcggcgatgtgggctacctagacacgcatggc
aatgtcgtcatctcgggcagactcaaggagctaatcatcacagccggcggcgagaatata
ccacctgtgcacattgaggagctgatcaagcatgagttgccctgtgttagcaatgctttg
ttggtgggcgatcatcgcaagtatctgacggtgctgttggccttgaagaccaaatctgat
gccagtacgggtctgccgctggatcagctgcgcgaggagacaattgaatggctaaacgaa
ctgggtctacaacaaacgcttctctccgagctgcttaatatacccgccgatctgcagttg
cccagcgacgcgaatgctctggccgcagctctagagatcaatgccgagcccaagctcttg
gaggccttggaggcaggcatcaagcgggccaataaaaatgccatctccaaggctcagtgt
gttcaaaaatttgctttgcttccccacgaattcaccttggccaccggggaactgggtccc
acactcaaaatcagacgcaatattgtccacactaagtacggaccgttgattgatcgactc
tacaaatga

DBGET integrated database retrieval system