KEGG   Drosophila virilis: Dvir_GJ18260Help
Entry
Dvir_GJ18260      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09583  protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dvir_GJ18260
Chaperones and folding catalysts [BR:dvi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dvir_GJ18260
Membrane trafficking [BR:dvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dvir_GJ18260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 AhpC-TSA OST3_OST6 Thioredoxin_6 Redoxin DUF1143 NanE
Motif
Other DBs
NCBI-GeneID: 6634224
NCBI-ProteinID: XP_002057673
FlyBase: FBgn0205421
UniProt: B4M970
Position
Unknown
AA seq 513 aa AA seqDB search
MSRHRQFVMLLMLLLLALVAAKSKISAVQEDIIDYKDFKKLLRTKNNVLALYVSSAKEAA
AELKVFRETAEAIRGTGTMLYVDCSNQERKKLCKKLKVTPTPYTLRHYKDGDYHKDYDRQ
LSVNSMITFMRDPAGDLPWEEDPAGADVLHFSDAAAFSKHLRKDIRPMLVMFHVPWCGFC
KRMKPDYSKAATELKAQGGYLLAAMNVERQENAPVRKLFNLTGFPTLIYFENGKMRMTYE
GENTKDALVAFMLNPNVKPTPKPKEPDWSADTNSEIVHLTTQGFEPALKDEKSVLVMFYA
PWCGHCKRMKPEYEKAALEMKHNNVPGMLAALDATKEPTIGEKYKVKGYPSIKYFSYGVY
KFDVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEDDSSEVHFLNDKTFSSTLKRKKHAL
VMFYAPWCGHCKHTKPEFTAAANALQDDPRVAFVAVDCTKHAALCAKYNVRGYPTLIYFS
YLKTQLEYNGGRTSKDFIAYMNNPPSSKDHSEL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggcaccgtcagtttgtaatgctgctcatgctcctgttgctggcacttgttgcc
gccaaatcgaaaatctctgctgtgcaggaggacataatagactacaaagacttcaagaaa
ctactgcggacgaagaacaacgtacttgctctctatgtatccagtgccaaggaggctgct
gccgagttgaaggtgtttcgggagacagcagaagcgatacgcggcacaggaactatgttg
tatgtggattgctccaatcaggagcgcaagaagctctgcaagaagcttaaagtaacgccc
acaccgtatacactgcgccactacaaggatggggattaccacaaggactacgatcgtcag
ctgagcgtaaactccatgataacatttatgcgcgatccagcaggtgatttaccctgggaa
gaggaccctgccggtgcggatgtattgcactttagtgacgccgccgcatttagcaaacat
ctgcgcaaggatatacggcccatgctggtcatgtttcatgtgccgtggtgcggcttttgc
aagcgcatgaagccggactacagcaaagcagctaccgaacttaaggcacaaggtggatat
ctgttggccgccatgaatgtggagcgacaagaaaatgctccagtgcgcaaattgtttaat
ctaactggttttcctacattaatttactttgagaacggaaaaatgcgcatgacctacgag
ggcgagaataccaaggacgcattggtagcatttatgctgaatcccaatgtgaagccaacg
cccaagccaaaggaacccgactggtcggctgacacaaactcagaaattgttcatctcact
acgcagggctttgagccagcgctaaaggatgaaaaatccgtgctggtcatgttttatgct
ccctggtgcggccattgcaagcgcatgaaaccggagtacgaaaaggcagcgcttgagatg
aagcataacaatgtgccaggaatgctcgccgcactggatgccactaaagaaccgaccatt
ggcgaaaagtacaaagttaagggctatccaagtataaaatacttttcgtatggtgtttac
aaattcgatgtaaatgtacgcgaggcttccaaaatagtcgaatttatgcgagacccgaaa
gagccaccaccaccgccgccgccggagaagagctgggaggaggaggatgacagctctgag
gttcattttcttaacgataaaacctttagctcgacactgaaacgcaagaagcacgcgctt
gttatgttttatgctccatggtgtggtcactgtaagcacacaaaaccggaatttacggct
gccgcaaatgcgctgcaagatgatcctcgagttgcctttgttgccgtcgactgcacaaaa
catgctgccctttgcgccaagtacaatgtgcgcgggtatcccaccttaatatacttctcc
tacctcaaaacgcagctcgaatacaacggcggacgtaccagcaaagatttcatagcctat
atgaacaatccacccagctcgaaggaccatagcgaactgtga

DBGET integrated database retrieval system