KEGG   Drosophila virilis: Dvir_GJ19045Help
Entry
Dvir_GJ19045      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dvi  Drosophila virilis
Pathway
dvi00564  Glycerophospholipid metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvir_GJ19045
Enzymes [BR:dvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     Dvir_GJ19045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Citrate_synt LupA
Motif
Other DBs
NCBI-GeneID: 6632193
NCBI-ProteinID: XP_002054981
FlyBase: FBgn0206190
UniProt: B4M307
Position
Unknown
AA seq 500 aa AA seqDB search
MPFASQQMQSVASQQLSKSDTIKLRNKHIGQACQLFYRSDPLKIVRGQGQYMFDEEGTRY
LDCINNVAHVGHCHPEVVRAGALQMATISTNNRFLHDELVQCARTLTSKMPAPLSVCFFV
NSGSEANDLALRLARNYTKRLDVITLDHAYHGHLQSVMEISPYKFNQPGGEQKPEYVHVA
PCPDIYGGQFTDKLHPNADLGALYAQPIADICERQQAKGQGVAAFIAESLQSCGGQILPP
AGYFQAAYNAVHRAGGLCIADEVQVGFGRVGSHYWAFETQGVVPDIVSVAKPMGNGHPVG
AVVTTPEIAQAFYDTGVAYFNTYGGNPVSCAIANAVMRIIDEEGLQQNAHQLGEYLLREC
SQLKQEFECIGDVRGLGLFVGIELVSDREARMPDTKAAHWVVNRMKQLHKVLVSSDGPND
NVIKLKPPMCFNHENADEFLLAFRECLTTLTQEQLQQSAAAAAAAASSAVTTNGVIATAA
DTLANKTKMFERQDRLIKSV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgcaagtcaacaaatgcaatccgtggccagccagcagctgtcaaaatcggac
accatcaagctgcgtaacaaacacattggacaagcctgccaactcttctatcgctccgat
ccattgaaaatagtccgcggacagggtcagtatatgttcgatgaggagggcacacgctat
ctggactgcatcaataatgtggcacatgttggccactgccatccggaggtggtgcgtgct
ggggccctgcagatggccaccatctcgacgaacaatcggtttctgcacgacgagctggtg
cagtgcgcccggacgctgaccagcaagatgccggcaccgttgtcggtctgcttctttgtc
aactccggatcggaggcgaacgacttggcgctgcggctggcgcgcaactataccaagcgc
ctggacgtgatcacgctcgaccacgcttaccatggtcacttgcagtccgtgatggagatc
tcgccgtacaagttcaatcagcctggcggcgagcagaagcccgagtatgtgcatgtggcg
ccatgcccggacatctatggcggccagttcaccgataagctgcacccgaatgcggatctg
ggcgccctctatgctcagcccatagcggacatctgcgagcgccagcaggccaagggccag
ggcgtcgccgccttcattgcggagagcctgcagagctgcggtggccagatattgccgccc
gccggctacttccaggccgcatacaatgcggtgcatcgcgcaggcggcctctgcattgcc
gatgaggtgcaggtgggcttcggccgcgtgggcagccactactgggccttcgagacacag
ggcgtggtgccggacattgtcagcgtggccaagcccatgggcaatggacatccggtgggc
gctgtggtgaccaccccagaaatagcacaggccttctatgatacgggcgtggcctatttc
aatacgtacggcggcaatccggtgtcctgtgccattgccaatgcggtgatgcgcatcatc
gacgaggagggactgcagcagaacgcccaccagctgggcgagtatctgttgcgggagtgc
agccagctgaagcaggagttcgagtgcattggcgatgtgcgcggcctcggcctgtttgtg
ggcatcgagctggtcagcgatcgggaggcgcgcatgcccgacaccaaggccgcccactgg
gtggtcaatcgaatgaaacagctgcacaaggtgctcgtctccagcgacgggcccaacgac
aatgtcatcaagctaaagccgcccatgtgcttcaatcatgagaatgccgatgagtttctg
ctcgcgttccgcgaatgcctgaccaccctcacccaggaacagctgcaacagtcagccgca
gcggcggctgcggcggcgtcgtcggccgttaccacaaacggtgtcattgccaccgccgcg
gacacattggccaacaagacgaaaatgttcgagcggcaggatcgtctcatcaaatccgtg
tga

DBGET integrated database retrieval system