KEGG   Drosophila virilis: Dvir_GJ19065Help
Entry
Dvir_GJ19065      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K21863  sodium leak channel non-selective protein
Organism
dvi  Drosophila virilis
Brite
Ion channels [BR:dvi04040]
 Voltage-gated cation channels
  Sodium leak channel, non-selective
   Dvir_GJ19065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans
Motif
Other DBs
NCBI-GeneID: 6631335
NCBI-ProteinID: XP_002054937
FlyBase: FBgn0206210
UniProt: B4M2W3
Position
Unknown
AA seq 2095 aa AA seqDB search
MIDRLQIRRLGAAARRKRAGGGSSFHTVSGITTPATASTSSSSGNSFTPQQHLHSHPHQH
QHSIIGSSQQQISQISLNPSSGSSPCNGLGTRQDASSVLNSPTTIVNSGSCNSTAYGMQQ
QVGGLSTAAVTSTPTVIGSHTASNALNNGAGGAVCPVGGVSGGLNLLGSIGGLGGGAAVA
GMGICGGISSTVGSAAITGVPPIGLGIATGIGNKIMLGRKQSLKGGEPFLADYGPEESLN
ESADIEWVNKLWVRRLMRLCALVSLASVSLNTPKTFERHPSLQYITFVSDTAVTVLFTAE
MIAKMHIRGVLNGEVPYLKDHWCQFDASMVSFLWVSIILQIFEVLEIVPKFSYLSIMRAP
RPLIMIRFLRVFLKFSMPKSRINQIFKRSSQQIYNVTLFFLFFMSLYGLLGVQFFGELKN
HCVMNNTGYDQLGRPVLTINSLAIPDTFCSMDPDSGYQCSPGMRCMKMDFLSSYVIGFNG
FEDIATSIFTVYQAASQEGWVFIMYRAIDSLPAWRAAFYFSTMIFFLAWLVKNVFIAVIT
ETFNEIRVQFQQMWGARGHIQKTAASQILSGNDSGWRLVTIDDNKHGGLAPETCHAILRS
PYFRMLVMSVILANGIVTATMAFKHDGRPRHVFYERYYYIEVIFTCLLDLETMFKIYCLG
WRGYYKHSIHKFELLLAAGTSLHIIPIFYLSGLTYFQVLRVVRLIKASPMLEGFVYKIFG
PGKKLGSLIIFTMCLLIISSSISMQLFCFLCDFTKFESFPEAFMSMFQILTQEAWVEVMD
ETMIRTSKTLTPLVAVYFILYHLFVTLIVLSLFVAVILDNLELDEDIKKLKQLKFREQSA
EIKETLPFRLRIFEKFPDSPQMTILHRIPNDFILPKVRESFMKHFVIELETEDPSLVENC
KRPMSECWESNVVFRKQKPVRIMNKTAKVRAAGSSLRKLAITHIINDSNNQRLMLGDSAM
LPVVGTKGGLKSQGTITHSKPWRVDQKKFGSRSIRRSVRSGSIKLKQTYEHLMENGDIAA
APRANSGRARPHDLDIKLLQAKRQQAEMRRNQREEDLRENHPFFDTPLFLVPRESSFRKI
CQKIVHARYDARLKDPLTGKERKVQYKSLHNFLGLVTYLDWVMIFATTLSCISMMFETPS
YRLMDHPTLQIAEYGFVIFMSLELALKILADGLFFTPKAYIKDVAAALDVFIYVVSTSFL
CWMPHNIPTNSAAQLLMILRCVRPLRIFTLVPHMRKVVYELCRGFKEILLVSTLLILLMF
IFASYGVQLYGGRLARCNDPTIIRREDCVGVFMRRVFVTKMKLTPGPDESYPAMLVPRVW
ANPRRFNFDNIGDAMLTLFEVLSFKGWLDVRDVLIKAVGPIHAIYIHIYIFLGCMIGLTL
FVGVVIANYSENKGTALLTVDQRRWCDLKKRLKIAQPLHLPPRPDGRKIRAFTYDITQHI
IFKRVIAVVVLINSMLLSITWIKGEVHTERLVIVSAVLTFVFVVEVVMKNIAFTPRGYWQ
SRRNRYDLLVTVAGVIWIILQTILRNDLSYFFGFMVVILRFFTITGKHTTLKMLMLTVGV
SVCKSFFIIFGMFLLVFFYALAGTILFGTVKYGEGIGRRANFGSPVTGVAMLCRIVTGED
WNKIMHDCMVQPPYCTLGENYWETDCGNFTASLIYFCTFYVIFTYIVLYSTSGXVTNELL
QNIISYDISRAAIIMENFSLFYSNEEDALLSYADIRNFQNTWNIVDIHQRGVIPVRRVKF
ILRLLKGRLECDPQKDRLLFKYMCYELDKLHNGEDVTFHDVINMLSYRSVDIRKALQLEE
LLAREEFEYLVEEEVAKMTIRTWLEGCLKKIRAQNASKQQNSLIAGLRATNEQLVMRANV
QEDKTSGGILEKSAISTISGAVAGTCPPTSDAFSPTLSSTENDEKDVSSSAVMLPHTDSH
VSSVRHVMTVGKRAYALNRSDSTGSSAGRKFLAPTSSDPQQRSTLSDKERLHISSQQRKK
NSMTTLPHVVQLGQLGKQRETNKSSSFFSQLNSEIGQFYYPTINATAVAVAALHSFADHH
QHLHGPLSSPSAIISQLIGGSGKLIPFNNQANAVYEVHDWWQEQVLCSQTSDEEV
NT seq 6288 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccgcttacagattcgtcgcttgggtgcagctgctagaagaaaacgcgcggga
ggcggaagcagctttcacaccgtcagcggcattacaacgccagcgacagctagcaccagc
tcctccagcggaaacagtttcacacctcagcaacatctacattcacatcctcatcaacac
cagcactcgattatagggagctcccagcagcaaatcagtcagataagccttaacccatcg
tcgggtagcagcccctgcaacggattgggcacacgtcaagatgcatccagcgtgctcaac
agtccgacaactattgtgaactcgggcagctgcaacagcactgcttacgggatgcaacag
caggttggaggcttgtcaacagcggctgtgacaagtacgccgacagttataggcagccac
actgcaagcaatgccctcaacaacggagcgggaggagcagtttgcccagtgggaggtgtt
agtggaggcctcaatctgctgggcagcattggcggtctgggaggtggagccgccgtcgct
ggtatgggcatttgcggtggtataagcagcaccgttggcagtgctgctattacaggagtg
ccgccaatcggattggggattgccacaggaattgggaataagattatgctgggccgaaag
caaagcctcaaagggggtgaaccctttttagctgactacggcccggaggaatcgttaaac
gagagcgcagatattgaatgggtgaacaagctatgggtgcgacgattgatgcgtttgtgc
gccttagtctcactggcgtctgtctccttaaatacgccgaagaccttcgagcgtcatccc
tcattgcagtatatcacgtttgtctcagacacagctgtgacagtgctcttcacggccgaa
atgattgctaaaatgcacattcgtggagttctaaatggcgaggtgccttaccttaaggat
cattggtgtcagtttgatgcctccatggtaagctttctatgggtctccatcatacttcaa
atattcgaagtacttgaaatcgtgcctaaattctcctacttatctattatgagggctccg
cgtccgcttattatgatacgctttcttcgtgtttttcttaaatttagtatgcccaagagc
cgcatcaatcaaatcttcaaacgctcaagtcagcagatttataatgtgacgctattcttt
ttgttcttcatgtcgttgtatggacttctcggtgtgcagttttttggagagctgaaaaat
cattgtgttatgaataacaccggttatgatcagttgggcaggcctgtgctcacaattaac
tcattggcgataccagacacattctgctcaatggatcctgactcaggttatcaatgctcg
ccgggcatgcgttgcatgaaaatggattttttaagtagttacgttataggcttcaacggc
ttcgaggacattgcgacaagtatttttacagtatatcaagccgcttcgcaagaaggatgg
gtttttattatgtatcgcgcaatagactcactcccggcatggcgtgcggcattctacttc
agcactatgattttttttttggcttggctggttaagaacgtgtttatagctgtcataacg
gaaactttcaacgagatacgcgtccagtttcagcagatgtggggagccagaggccacata
caaaagacggctgcttctcaaatacttagcggaaacgattcgggctggcgattggtcaca
atcgatgacaataagcatggcggattagcacctgagacctgccatgcaattttgcgctct
ccatattttcgaatgctggttatgtcggttatacttgccaatggtattgtgacggccacg
atggcatttaagcatgacggtaggccacgtcatgtattttatgagagatattactacata
gaggtgatctttacgtgtctcctcgatctcgaaacaatgtttaaaatatactgcctgggt
tggcgtggctattacaagcattctatacacaagtttgagctgttgcttgcagctggtact
tcattacacataattcccatcttctatctgtctggattgacttattttcaagtgcttagg
gtagtgcgactcataaaagcctctcctatgctagaaggctttgtgtacaaaatttttgga
cccggaaaaaagctaggctcgcttataatcttcaccatgtgcttactaatcattagctca
agcatttcaatgcaactattttgctttttatgcgacttcaccaagtttgagtcgttcccg
gaggcgtttatgagtatgtttcagattctaacgcaggaagcgtgggtggaggtaatggat
gaaacgatgatacgcacaagtaaaacgctgacaccgctagtagccgtttattttatatta
tatcatctttttgttacgctcatcgtgctcagtcttttcgtagcagtaatattggataat
ttggagttggacgaggacattaagaaactaaagcagcttaagtttcgcgagcaaagtgcg
gaaataaaggagacccttccctttcgattacgaattttcgaaaagtttccagactcacca
caaatgaccattcttcatcgcattccaaatgattttatactgcctaaggtgcgtgagagt
tttatgaaacattttgtaattgaattggaaacggaggacccatcgcttgtggaaaactgt
aaacggccgatgtctgagtgttgggagtccaatgttgtttttcgtaagcaaaaaccagtg
cgcattatgaacaaaaccgcaaaagtgcgagcagcaggaagcagcctccgaaaattggcc
atcactcatattataaatgacagtaacaatcagcgtcttatgctgggtgactcggccatg
ttgccagtggtgggcactaagggcggcctaaaatcacagggtaccattacacattccaag
ccatggcgggttgaccagaaaaaatttggatcccgctccatacgtcgcagcgtgcgctct
ggatctattaaactaaagcagacatatgagcatctaatggagaatggtgacattgctgct
gcacctcgcgccaattccggccgggctaggcctcacgacctagatatcaagctgttgcaa
gcgaagcgtcagcaagcagaaatgcgacgcaatcaacgcgaggaagatttacgtgagaat
catccgttctttgacacgccgctatttcttgtgcctcgagagagtagttttcgtaagatc
tgccaaaaaatcgttcatgcacgctatgatgcgaggctcaaagatccattaactggaaag
gagcgcaaggtgcaatacaagagcttgcataacttccttggtctagtcacttatcttgac
tgggttatgatttttgctaccactctttcgtgcatctcaatgatgttcgagacccccagt
tatcgtttaatggatcatcctacgctccagatcgccgaatatggttttgttattttcatg
agcctggagcttgctctgaaaattcttgctgatggtttgttctttacaccaaaagcttac
atcaaggatgtggctgcagcgcttgacgtctttatatacgtagtttcaacttcatttctt
tgctggatgccacataacatacccaccaattctgcggcccaactgctgatgattctgcga
tgcgtgcgcccgctgagaatcttcacgctggtaccccacatgcgaaaagtggtctatgag
ctgtgtcgcggctttaaagaaatcttattagtttcaacgttgttgattcttctcatgttc
atctttgctagttacggagtacagctttatggtggtcgtttggcacgctgtaacgatccc
acaataattcgtcgtgaggattgcgttggtgtatttatgcgacgcgtatttgtcactaaa
atgaagctgacaccgggtccagacgagtcctatccagccatgttggtgccgcgagtctgg
gccaatccccgtcgctttaactttgacaatattggtgatgccatgcttacactcttcgag
gtgctatcgttcaagggttggttagatgtgcgcgatgttctcattaaagccgttggaccg
attcatgctatttacatccatatctatatatttttgggttgcatgatcggcttgactctt
tttgttggtgtagtcatcgcaaactattcagagaataaaggcacagcattgcttaccgtt
gaccagcgccgatggtgtgacctaaaaaagcgccttaaaatcgctcaacctcttcattta
cctccacgtccggatggacgaaagattcgcgcgtttacttatgacattactcagcacatt
atcttcaaacgggtcattgctgtggtagtgctcatcaacagcatgttgctgtctataacg
tggattaagggcgaagtccacacggaacgtctggtcattgttagtgctgtcctgaccttt
gtttttgtcgttgaagtggttatgaaaaacattgcatttacacctcgtggctattggcaa
tccaggcgtaatcgatatgacttactagtaaccgttgctggcgtgatctggattatatta
caaacaattctcaggaacgatttatcgtacttcttcggatttatggtagttattctacgg
ttttttactatcactggaaagcacaccacactaaagatgctcatgttaacagtcggtgtg
tccgtgtgcaaatcctttttcatcatctttggaatgtttcttttggtattcttttatgct
ttggccggcaccattctatttggtaccgtcaagtatggggaaggtattgggcgacgcgcg
aactttggatcaccagtgacgggtgtggccatgctgtgtcgtattgtgactggtgaggac
tggaataaaatcatgcatgattgtatggtgcagcctccatactgcactttaggtgaaaat
tactgggaaacggattgcggaaactttacagcaagtttgatctatttttgcacattttac
gttatatttacgtacattgtgctttattctactagtgggtaggtaacaaatgaattgcta
cagaacataatctcatatgatatttctcgcgcagctattattatggagaatttttctctg
ttctactcaaatgaggaggatgctttactgtcctatgcagacatacgtaattttcagaac
acttggaatattgtggacatccatcagcgcggagttatacctgttcgaagggttaaattc
attttgcggcttttaaaaggccggctggagtgtgatcctcaaaaggatcggttgctattt
aagtacatgtgttatgaactagacaagctgcacaacggcgaagatgtaacctttcacgat
gtaattaacatgctatcgtatcgctctgtagacatacgtaaagcgctacagctggaggaa
ctgctagcgcgtgaggagttcgaatacctggtggaagaggaagtagccaagatgacaata
cgtacctggcttgaaggttgtctaaagaagatacgggcacaaaatgctagcaaacaacaa
aactcactgattgcaggattacgtgccactaatgagcagttggtgatgcgtgccaatgtg
caggaggacaaaacgtccggtggaatattagaaaaatcagctataagcacaataagtggt
gcagttgccggtacttgcccgcccacaagtgatgccttctcaccaactttaagctcgacg
gaaaatgatgaaaaggatgtcagcagtagcgcagttatgctgccccacactgattcacac
gtttctagtgttcgccatgtcatgacagttggcaagcgtgcatatgctcttaatcgcagc
gattcgactggtagttcggcagggagaaaatttttggcacccacatcgagcgatccacag
cagcgctcaacactaagtgacaaggagcgactacacattagcagccagcagcgtaaaaaa
aattcgatgaccacactacctcatgttgtccagctgggtcagctgggaaaacagcgtgag
acaaacaagtcatccagttttttttcgcagctaaacagcgagattggacagttttactat
ccgaccattaacgcgactgctgttgctgttgccgcactgcattcctttgcggatcatcat
cagcatcttcacggaccgctgagtagtccctcggccataataagtcagttaattggaggc
agcggaaaactgataccattcaacaatcaggcaaacgctgtatatgaggtacatgactgg
tggcaagagcaggtgctgtgctcgcagaccagcgacgaagaggtataa

DBGET integrated database retrieval system