KEGG   Drosophila virilis: Dvir_GJ19665Help
Entry
Dvir_GJ19665      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dvi01001]
    Dvir_GJ19665
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     Dvir_GJ19665
Protein kinases [BR:dvi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   Dvir_GJ19665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 APH Pkinase_fungal 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 6636211
NCBI-ProteinID: XP_002059712
FlyBase: FBgn0206807
UniProt: B4MF09
Position
Unknown
AA seq 428 aa AA seqDB search
MPLFGKKDSGKKPKTKDTKELNKQMSIDEKYNLHGLLGTGAFSEVRLAESKDTPGDHFAV
KIIDKKALKGKEESLENEIRVLRRFSANHFDGNSPNGTRLTHPNIVQLLETYEDKAKVYL
VMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPD
DDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCG
YPPFYDENDANLFAQILKGEFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALAHP
WISGNEASSKNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALSSNSSASAPTLNI
STDNGNGKICVKSEAEATAPIQPAAAAAPLSASSTSSVNESAQPLSPHNDINNHQRISPN
CSFSGQAN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccactgtttggcaaaaaagattctggcaaaaagcccaaaaccaaggatacgaaggag
ctgaacaaacagatgtcaattgatgaaaagtacaatctccatgggctcttgggaacgggc
gcattctcggaggtgcgcttagccgaaagtaaagatacgccgggcgatcattttgcggta
aaaatcattgataagaaagctctaaagggcaaagaggaatcgctagaaaatgaaatacgc
gtactgagaaggtttagtgcaaatcatttcgatggcaacagtccgaatggaacgcggctg
actcatccgaatatagtgcaacttcttgaaacatacgaagacaaggctaaggtgtatctg
gtcatggaattagtgacaggtggagaattgttcgaccgcatagttgagaagggatcctac
acagagaaggatgcatctcacttaattagacaaatcttagaggctgtagactatatgcat
gagcagggagtagtacatagggatctcaaaccggaaaacctactatactatagtccagat
gatgacagtaaaataatgataagcgattttggcttatcgaaaatggaagattctggtatc
atggcaactgcatgcggaactccagggtatgttgcgccagaggtgctggcccagaagcca
tatggcaaggctgttgacgtttggagcataggcgttatatcctatatactcctttgtgga
tatcctccattttacgatgaaaacgacgccaatttatttgcacaaattcttaaaggtgaa
tttgaattcgattcgccatattgggacgaaataagcgagtcggccaagcattttatcaaa
aatttaatgtgtgtcactgtcgaaaaacgctatacatgcaaacaagcactggcacatcct
tggatatctggaaatgaggccagcagcaagaacattcatggcactgtttcggagcagttg
aagaaaaactttgccaagagtcgatggaagcaagcatattacgctgcgactgtaatccga
caaatgcagcgaatggcgcttagcagcaacagcagtgcttcagctcccactctgaatata
tctactgacaatggtaatggcaaaatctgtgttaaatctgaggcagaagctaccgcgccc
attcaaccagccgcggcggcagcgccactctcagcctcaagcacatcgtctgtgaatgaa
tcagcacaacccttgagcccacataacgacatcaataatcaccaaagaatttcgccaaat
tgtagtttcagcggccaagcgaactaa

DBGET integrated database retrieval system