KEGG   Drosophila virilis: Dvir_GJ19990Help
Entry
Dvir_GJ19990      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
dvi  Drosophila virilis
Pathway
dvi00562  Inositol phosphate metabolism
dvi01100  Metabolic pathways
dvi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dvir_GJ19990
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Dvir_GJ19990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dvi01009]
    Dvir_GJ19990
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     Dvir_GJ19990
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     Dvir_GJ19990
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    Dvir_GJ19990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase Y_phosphatase3 Rootletin FSIP2 GRAM Vps36_ESCRT-II RasGAP_C Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 6626897
NCBI-ProteinID: XP_002050819
FlyBase: FBgn0207131
UniProt: B4LMB7
Position
Unknown
AA seq 760 aa AA seqDB search
MDFTRFMNKFNEIERQLSPTSALRLSFDNISPESEEPPDGKRLWGVPVPPFVSDKVVSWI
AEEFNEAPVYYNGNCVLKKVENVRMIDRYNTKNPTVGTLYLTATHLIFVEPDSNKETWIL
HMHIASIEKLPLSTTGSPLLIRCKTFLSVTFVIPKDSECHDVYTSLIKLFQPVSINKLYC
FNYQPAKDDYPKNAGWDFFKLEAEFKHMLVPNDNWTLCSMNEKYELCDTYPRQIYVPKEA
TTLMLISSSRFRSKGRLPALTYLHNNKASICRCSQPLSGFSARCLEDEQMLEAIRKTNPN
TDYMFVVDTRPRINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACEQ
KSPTMSAFLNALESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLAQ
LMLNPYYRTIKGFQALIEKDWLAFGHKFSERCGHIQTDAREVSPIFTQFLDCTWQLMSQR
SESFEFNERFLLILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYINP
LYKPNIDESIKANLAPQCIKFWRGMYSRFESGIHPREPLGDLLLDSKEHCNSLEDHVQHL
TKRIASFKNYISKSAKKLQDATTTTTTKASKETTTNEINDNKYNYDKKLSELSAADDDHP
LKASNMSFANLSLNAEQASTQTLTEEISSVALDWKSMRNVTTCSCSTPFDQFSKKTHCWR
CGEIFCERCIDKNVALPGHDSGKPVPVCRGCHRQMQKQSP
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggattttacaagattcatgaataaattcaacgaaatcgaacgccaactttcgcccaca
tcggcgctgcgtctgagctttgataatatatcgccggagagcgaggagccgcccgatggc
aagcggctgtggggtgtgccagtgccaccatttgtctccgataaggtcgtctcctggatc
gcggaggagttcaacgaggcgcccgtttactacaacggcaactgtgtcctaaaaaaggtg
gaaaatgtgcgcatgattgatcgctacaacactaaaaatcctacagttggcactttgtat
ctgacggccacgcatctgatattcgtggagcccgacagcaataaggagacctggattctg
cacatgcacattgccagcattgagaagctgccgcttagcacaaccggttcgccgcttttg
atacgctgcaaaacttttctgtcggtgacatttgtcatacccaaggactccgagtgccat
gatgtctatacttcgctaatcaaactctttcagccggtctccatcaacaagttgtactgc
ttcaactatcagccagccaaggatgattaccccaaaaatgctggctgggactttttcaaa
ttggaggcagagtttaagcacatgctggtgcccaacgacaactggacgctgtgctccatg
aacgaaaagtacgagctgtgcgacacgtatccgcgtcagatctatgtgcccaaggaggcc
accacattgatgctcataagcagctcacgttttcgctccaagggtcgcctgcccgcattg
acctatttgcacaacaataaggcgtccatatgccgctgcagtcagccattgtcgggcttc
agtgcccgttgtctcgaggacgagcaaatgctggaggccatacgcaaaaccaatcccaat
accgattacatgttcgttgtggatacgcgaccgcgcatcaatgccatggccaatcgtgcc
gccggcaagggctatgagaacgaggccttttacgagaacatcaagttccatttccttggc
attgagaacattcacgtacagcgcgccagcctacaaaaggtgctggaggcttgcgaacag
aaatcacccacgatgagcgcatttctgaatgccctagagtcatccggctggcttaaacac
attcgctccatattggacacgtcgagcttcattgccaacgccgtcgacaagggcgtctcc
gtggttgtacactgctcggatggctgggatcgcactgctcaagtttgctcgctggcgcag
ctcatgttgaatccttactatcgcacaattaagggctttcaggcgctcatcgagaaggac
tggctggcgtttgggcacaagttcagcgaacgctgcggccacatacagacggatgcgcgc
gaggtgtcgccaatctttacgcagttcctggactgcacctggcagctaatgtcccagcgc
agcgagtcttttgaattcaatgaacgctttctgctcatactccatgaccatgtgcactcg
tgtcagttcggcacttttgtgggcaattgcgagaaggatcgcctggacctgaagctagcc
gagcgcacattctcgctgtggggctacatggccaaccatctgaacgagtacataaatccg
ctgtataaacccaacatagatgagtcgatcaaagccaacctggcgccacagtgcatcaag
ttctggcgtggcatgtacagccgctttgaaagcggcatacacccacgcgagccattgggt
gatttgctgctggacagcaaggagcactgtaactccctggaggatcatgtgcagcacttg
acgaaacgtattgccagtttcaaaaactacatttccaagtcggccaagaagctgcaggat
gccaccaccacaaccaccacaaaagctagcaaggagacgaccaccaacgagatcaatgac
aacaaatacaattatgacaagaagctaagcgaattgtccgccgctgatgatgatcatccg
cttaaggcgagcaacatgtcatttgccaatctctcgttaaatgccgaacaggcgagcacc
cagactttgaccgaggaaatctcttccgtggcccttgattggaagtccatgcgaaacgta
accacctgctcctgctccacgcccttcgatcagttcagcaagaagacacattgctggcgt
tgcggcgagatcttctgtgagcgttgcattgataagaacgtggcgttgcctggacacgat
agcggcaagccggtgcccgtttgtcgtggctgccaccgacagatgcaaaaacagagtcca
taa

DBGET integrated database retrieval system