KEGG   Drosophila virilis: Dvir_GJ20658Help
Entry
Dvir_GJ20658      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dvi04131]
    Dvir_GJ20658
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dvir_GJ20658
Membrane trafficking [BR:dvi04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    Dvir_GJ20658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank DHHC
Motif
Other DBs
NCBI-GeneID: 6629206
NCBI-ProteinID: XP_002052625
FlyBase: FBgn0207796
UniProt: B4LSF8
Position
Unknown
AA seq 636 aa AA seqDB search
MLGRRLTGERSIANSKTAVAQKANKIAHLLENPLHHQPPLSGGTAERLGVEFDFYNVASS
KVHPSPGAARSVWALPLTASSSCNMEEDGHAHADIDIDIDHRPHSPPGTNGPANNGEGSE
HDSNMLLFEGLDGATVNLDDIFDIIKSGEVSEVENLVEKFGMECLSARDRHGYTPAHWIA
LNGNVQLMRYLIERTAPIDLPCLGTQGPRPIHWACRKGHASVVQVLLQAGVAVNAADFKG
LTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHGDLMRLLMYSGVELQ
KTDNFGSTPLHLACLSGNINCVRLLCEKSQLELEPRDKNGKTPIMLAQAHQHQDVVRLLY
GEVKKKSRWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRR
SHYCFIYWNVVMWVSWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHS
CRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFAC
YCVMIEGFTLLYVLGLIEAVVFCGLGWILTCTSILHACMNLTTNEMFNYKRYPYLRDKRG
RYQNPFSRGPILNLLEFFVCLPDRSDDNDLLLEDNI
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgctaggaaggcgactgactggggagcgcagcattgccaacagtaaaactgcggttgcc
caaaaagccaacaaaattgcacatttacttgaaaacccgttgcaccaccaaccaccgctt
tcgggtggcacagcggaacgtcttggcgtagaattcgatttctacaacgtggcctccagc
aaggtacaccccagtccgggggcagcgcgcagcgtttgggcgctgcccctgacggcctcc
tcgtcatgcaacatggaggaggatggtcacgcccatgcggacattgacattgacatcgat
catcgtccgcactcgccgccgggcaccaacgggccagccaacaatggagagggcagcgag
cacgacagcaacatgctgttatttgagggcttggacggcgccaccgttaatctggatgat
attttcgatattatcaagagcggcgaagttagcgaagtggagaatctggttgagaagttt
ggcatggaatgcctttcggccagagatagacacggctatacgcccgctcactggatagcg
ctcaatggcaatgtgcagcttatgcgttatttaattgaacgcactgcgcccattgattta
ccctgcttgggcacacagggacctcgacccatacactgggcctgtcgcaagggacatgcc
tctgtggtgcaggtgctgctgcaggcgggcgtggctgtcaacgcggcagatttcaaaggg
ctaacgcctctgcacctggcctgtatgtacggacgcactgcgacggcggcctatctcctg
ggcatgggtgcgttgaataatctaacggacatcaatggcgatacggcgctgcactgggcg
gcatataagggtcatggcgatctgatgcgtctgcttatgtattccggcgtggagctccaa
aagacggataactttggctcgacaccgctgcatctggcctgtctctccgggaacatcaat
tgcgtgcggctactgtgcgaaaagtcacagctggagctggagccgcgggataagaacggc
aagacgcctattatgttggcacaggcgcatcagcatcaggatgtggtacgtttactttat
ggcgaggtgaagaagaagtcacgttggataccatccgtatcggagagctggggctggctc
tttggcggcgccggcgactccaagggaccgctatttctcttcctcttctcggtgctgctt
tggggctatcccatgtacatgatacgcgccatacccatcacctggaacatattgaggcgc
tcgcattattgtttcatctattggaacgtggtcatgtgggtcagctgggccattgcgaat
cgccgtgatcccggctatataccgctcagctcggatgcctactatcgcgccatcaagcag
ataccctactttgacaagttgaagaaacggaatgtgatgctcacccggctgtgccacagc
tgccgctgcctgcgtccgctgcgcgccaagcactgccgtgtgtgcaatcgctgcgtctcc
tacttcgatcaccattgccccttcatctacaattgcgttggcctgcgcaatcgcatgtgg
ttcttcctgttcgtgctgtcggtggccgtcaattgctcatttaccatttactttgcctgc
tactgtgtcatgatcgagggcttcacgctgctctatgtgctcgggctgatcgaggcggtc
gtattctgcggtctgggctggatactcacctgcacttcgatcctgcatgcctgcatgaat
ctcaccacgaacgagatgttcaactacaagcgttatccatatttgcgggataagcgcgga
cgctatcagaatccattctcgcgcggtccgattttgaatctgctggagttctttgtttgc
ctgccggaccgaagcgatgacaacgatctgctcttagaggataacatttga

DBGET integrated database retrieval system