KEGG   Drosophila virilis: Dvir_GJ20693Help
Entry
Dvir_GJ20693      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dvi  Drosophila virilis
Pathway
dvi00062  Fatty acid elongation
dvi00071  Fatty acid degradation
dvi00280  Valine, leucine and isoleucine degradation
dvi00310  Lysine degradation
dvi00380  Tryptophan metabolism
dvi00410  beta-Alanine metabolism
dvi00640  Propanoate metabolism
dvi00650  Butanoate metabolism
dvi01100  Metabolic pathways
dvi01200  Carbon metabolism
dvi01212  Fatty acid metabolism
Module
dvi_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dvi_M00085  Fatty acid biosynthesis, elongation, mitochondria
dvi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dvir_GJ20693
   00650 Butanoate metabolism
    Dvir_GJ20693
  Lipid metabolism
   00062 Fatty acid elongation
    Dvir_GJ20693
   00071 Fatty acid degradation
    Dvir_GJ20693
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dvir_GJ20693
   00310 Lysine degradation
    Dvir_GJ20693
   00380 Tryptophan metabolism
    Dvir_GJ20693
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dvir_GJ20693
Enzymes [BR:dvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dvir_GJ20693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SLED UPF0051
Motif
Other DBs
NCBI-GeneID: 6625142
NCBI-ProteinID: XP_002049551
FlyBase: FBgn0207831
UniProt: B4LKU0
Position
Unknown
AA seq 293 aa AA seqDB search
MANIAKLFTVRAQTLVQAAARQPQVAARFSSTSSNYEFIKTEVTGEKKNVAVITLNRPKA
LNALCNGLMQELSTALKGFGKDANIAAIVLTGSEKAFAAGADIKEMAPNTYSQCIQGNFL
NDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGEKAKFGQPEIALGTIPGAGGTQ
RLTRVVGKSKAMEMCLTGNMINAQEAEKVGLVSKVIPADQLLGEAIKLGEKIGTHSNLIV
QLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMQAFVEKRPAKFTSE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggccaatattgcaaaactgtttaccgtgcgtgcacaaaccttggtccaggctgccgcc
cgtcagccacaagtggccgcccgtttcagcagcacctccagcaactatgaattcattaaa
accgaagtgactggagagaagaaaaatgtggctgttatcacattgaaccgtcccaaggca
ttgaatgcactgtgcaatggcctgatgcaggagctgtccaccgctctgaagggctttggc
aaggacgcgaatattgccgccattgtgctgactggcagcgagaaggcttttgccgctggc
gcagacatcaaggagatggcacccaacacatactcgcagtgcattcagggcaacttcctt
aacgactggacagaggtggctcgcacccagaagcccatcattgctgcggtcaatggttat
gcgctcgggggcggctgtgagctggcaatgatgtgcgacattatctatgccggcgagaag
gccaagttcggtcagccagaaattgcgctgggcaccatacccggtgcaggcggcactcag
cgtttgacccgtgtggtcggcaagtccaaggccatggagatgtgcctgactggcaacatg
atcaatgcccaggaggcggagaaggttggcctggtcagcaaggtcattccagccgatcaa
ctgctgggcgaggcgattaaactgggcgagaaaattggcacccactctaatttgattgtg
cagctgtgcaaggaggcggtcaataccgcatatgagacaaccctgcaggagggtctcaag
tttgagcgtcgcaccttccatgccacattctctacggctgatcgcaaagagggcatgcag
gcctttgtggagaaacgcccggccaaatttaccagcgaatag

DBGET integrated database retrieval system