KEGG   Drosophila virilis: Dvir_GJ21833Help
Entry
Dvir_GJ21833      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dvi  Drosophila virilis
Pathway
dvi00061  Fatty acid biosynthesis
dvi00071  Fatty acid degradation
dvi01100  Metabolic pathways
dvi01212  Fatty acid metabolism
dvi04146  Peroxisome
Module
dvi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dvir_GJ21833
   00071 Fatty acid degradation
    Dvir_GJ21833
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dvir_GJ21833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dvi01004]
    Dvir_GJ21833
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dvi04147]
    Dvir_GJ21833
Enzymes [BR:dvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Dvir_GJ21833
Lipid biosynthesis proteins [BR:dvi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Dvir_GJ21833
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Dvir_GJ21833
  Exosomal proteins of breast cancer cells
   Dvir_GJ21833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C Cas_APE2256
Motif
Other DBs
NCBI-GeneID: 6625763
NCBI-ProteinID: XP_002049874
FlyBase: FBgn0208951
UniProt: B4LNB5
Position
Unknown
AA seq 737 aa AA seqDB search
MFIEDDAQMDSFWVQSALGAIKAIAFVYDIITLPVYLVIQAPWKRRQDSRRVKAKPISKK
LLVDESSKYAADDIEAKIIKNEETELTYRTTEPPRDVHVKMLQENIDTLEKVFNYVAKTH
STKRCLGTRQILSEEDETQPNGRVFKKYNMGDYKWKNFIEAERMAASFGRGLRELGQAPR
QNIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAHCISETEVTTVITSHDLLPK
FRTLLDKCPNVDTIIYMEDQLHKTDTSGFKEGVKILPFAQVVKIGNDSKFENVPPKAEDI
AIIMYTSGSTGTPKGVLLSHKNCIATMKGFCDMVSIYPEDVLIGFLPLAHVFELVAESVC
LMTGVSIGYSTPLTLIDTSSKIKRGCKGDASVLRPTCMTSVPLILDRISKGINDKVNSGS
AFRKALFKFLYQYKVKWIQRGYQTPLIDKLVFKKVAKLMGGRVRIIMSGGAPLSADTHEQ
IKTCLCVELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGHYRVTNKP
YPQGEVLIGGDCVSQGYYKLPGKTNEDFFDEDGRRWFKTGDIGEVQSDGVLKIIDRKKDL
VKLQAGEYVSLGKVESELKTCGFIENICVYGDPTKQYTVALVVPNQKHLEELAERNGLKN
KTFEDLCSSPIMEKAILKEISEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKR
KDIQDKYQHDINRMYAS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcgaagatgatgcccaaatggatagcttctgggtgcagagtgcactgggcgcc
atcaaggcgattgcctttgtctacgacattataacgctgccggtttatttggtaatacag
gcgccatggaaacgtcgacaggactcacggcgagtcaaggccaagcccataagcaagaaa
ttgttggtcgatgagtcctccaagtacgccgcggatgacattgaggcaaagataatcaag
aacgaagaaactgagctgacataccgcaccacggaaccgccgcgcgatgtgcatgtgaag
atgctgcaggagaatatcgatacgttggaaaaggttttcaattacgtggccaagacgcac
tcgaccaaacgctgcttgggcacccgccagatactcagcgaggaggacgaaacacagcca
aacggacgcgttttcaaaaagtacaacatgggcgactataagtggaagaactttatcgag
gcggagcgcatggcggccagctttggacgtggactgcgcgaacttggccaggcgccgcga
caaaacattgtcatctttgctgagactcgtgccgagtggatgatagctgcccatggttgc
tttaagcaggcgatgcccattgtaaccgtctatgccacacttggcgatgacggcgtggcc
cactgcatcagcgaaaccgaagtaaccactgtcatcacctcgcacgatctgttaccgaaa
ttcagaactttgctggacaaatgcccaaatgtcgacaccatcatttatatggaagatcag
ctgcacaagaccgacacaagtggattcaaggaaggcgttaagattctgccatttgctcaa
gttgtgaaaattggaaatgacagcaaatttgagaacgtgccaccaaaggccgaggacatt
gccattatcatgtatacttccggctcaacgggcactccaaagggtgttctgttgtcgcac
aagaattgcattgcaacaatgaaaggcttttgtgacatggttagcatttatccggaagat
gtgttgatcggttttctgcccctggcgcatgtgttcgagcttgtcgcggagagcgtttgc
ctgatgactggcgtctccattggttactcaacgccgctgacgctaatcgacacgagcagc
aagattaagcgtggctgcaagggtgacgcctccgtgctgaggcctacgtgcatgacttcc
gtacctctgatactcgatcgcatctccaagggcatcaacgacaaggtcaactctggctct
gcattcaggaaagcgctctttaagtttctctaccagtacaaagtcaagtggatacagcgc
ggttatcagacaccattgatcgacaagctggtcttcaagaaggtggctaagctaatgggc
ggcagggtgcgcattattatgtccggcggtgcgccgctctcggccgacactcacgaacag
atcaagacgtgcctgtgcgtggaattgatacaaggctacggcctgacagagaccacttct
ggcgcaactgtgatggactatcgcgacatgacctatggacggactggaggacctttgact
gtttgtgacattcggttggttaattgggaagagggccattatcgtgttaccaacaaaccc
tatccacagggtgaggtactcatcggtggcgactgcgtatcgcaaggctactacaaactg
cccggtaaaaccaatgaggacttttttgatgaagatggacgccgttggttcaaaaccggc
gatattggagaagtgcaatccgatggcgtacttaagataattgatcgtaagaaggatttg
gttaagctgcaggctggtgaatatgtctccttgggcaaggtcgaatctgagttgaagacg
tgtggctttattgagaacatttgcgtttatggtgatccgacaaaacaatataccgtcgcg
ctggtcgtgccgaatcagaaacatctcgaagagttggccgaacggaatgggcttaaaaac
aaaacgtttgaagatttgtgctcatcgccaatcatggagaaggccatactcaaggaaata
agcgaacatgcgaggaaatgtaaattacagaaatacgaggtgcctgccgccattacgctg
tgcaaggaagtttggtccccggatatgggcctagtgacggctgctttcaagctgaagcgc
aaggacattcaagacaaatatcagcacgacattaatcgcatgtacgcttcatga

DBGET integrated database retrieval system