KEGG   Drosophila virilis: Dvir_GJ21996Help
Entry
Dvir_GJ21996      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dvir_GJ21996
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dvir_GJ21996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 6626819
NCBI-ProteinID: XP_002050171
FlyBase: FBgn0209110
UniProt: B4LQ79
Position
Unknown
AA seq 269 aa AA seqDB search
MKFRRNPLPRRLVDVLCFLTIVVVIPLGILYDFIFVLPAYHQPGGYAYAFTVLTVLFMFL
NGIANLIACMIVDTSVDQERVVLYSNGDVEPLNWRHCAICDKLAPPRSWHCKACGVCILK
RDHHCMFTGCCIGHLNYRYFVCFVFYLFVLSAHLLVYNSIHLKSFFSLLTIFHFWTDPWG
MLHKHLLSLNVLLFVITSITLVYNVPKMLRGRVCTECKASQKYNCGVNYNLKNIFGQQMY
IAWLSPLIKSQLPDDGYTWKSKSVDDKLK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccggcgcaatccattgccacgacgactcgtagacgtcctatgtttcctaacg
atagtcgttgtgataccccttgggattctctatgacttcatatttgtgttgccggcatac
catcagcctggcggatatgcatatgccttcacggtacttacagttctattcatgttcctc
aacggaattgcaaacctgattgcctgcatgatagttgacacaagcgtcgaccaagagcgt
gtcgtgctgtactccaatggggatgtggaacctctcaattggcgacactgtgccatttgc
gataagctggcacctcccagatcctggcattgcaaggcgtgtggcgtttgcatattgaaa
cgcgatcatcattgcatgttcacgggatgctgcattgggcatctaaattatcggtatttc
gtgtgctttgtgttctacctgttcgttttatcggcccacctgctagtttataattcgatt
catttgaagagctttttcagtttattgactatttttcatttctggaccgatccatggggt
atgctacacaagcatttgctttctctcaatgtgctgctattcgtcataacgtccataact
ttggtctataatgtgcccaaaatgttacggggtcgggtctgtacggagtgcaaggcttcg
cagaaatacaattgtggagtcaactacaatttaaaaaatatttttggccagcaaatgtat
atcgcttggctttctcctctgatcaaaagtcaattacctgatgatggttacacgtggaaa
tcaaagtcggtagacgacaagttgaaatag

DBGET integrated database retrieval system