KEGG   Drosophila virilis: Dvir_GJ22407Help
Entry
Dvir_GJ22407      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K17890  autophagy-related protein 16-1
Organism
dvi  Drosophila virilis
Pathway
dvi04136  Autophagy - other
dvi04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dvir_GJ22407
   04136 Autophagy - other
    Dvir_GJ22407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dvi04131]
    Dvir_GJ22407
   03029 Mitochondrial biogenesis [BR:dvi03029]
    Dvir_GJ22407
Membrane trafficking [BR:dvi04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    Dvir_GJ22407
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    Dvir_GJ22407
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dvir_GJ22407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 WD40_like KASH_CCD
Motif
Other DBs
NCBI-GeneID: 6626145
NCBI-ProteinID: XP_002050900
FlyBase: FBgn0209519
UniProt: B4LMX8
Position
Unknown
AA seq 610 aa AA seqDB search
MSTEEYVWRDHVVQKLRERDRKECETFKEIIVQNNRLIDHVAQLKSDNLKLSVENEQLRN
AVSTGGTGPNVAIATLEKKLLAQQEELTDLHKRKGEHSQMIVDLNLKVEQQKELIAEREH
SLYEQQTANNRLRAEVQLLHSSLEELKKLNTTLLDEHTALQLAFSSLEDKMRNVQDENRY
LLERLMRYRAKDADKLNEENESIIRKRSAKLKRDLEDAVREPNSAINQIVPATGSTPLHR
NSSPAQFSGTTVSDEEIDEGLINGAMEALGLNDEEYISARFTAGEIGHDLARIGTNMSME
TLKAAGYLGQPNPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKSSTEP
RAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQ
EPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLCTTDSLGSTIISGHYDKKIRFWD
IRTEKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFSNEHFKISC
DFARAAFNNCASKIACGSADGAIYIWNVNGFLETTLKGHSTAVNAVSWSPNSNSLASVGK
SKRCIIYSDS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaggagtacgtgtggcgcgaccacgttgtccagaaattgcgtgagcgagac
cgcaaggagtgtgaaaccttcaaggagatcatagtgcaaaacaaccggcttatagatcac
gttgcgcagctcaaatcggacaacctgaaattgtctgtggagaacgagcaactgcgaaat
gctgtgtcaacaggtggcaccggccccaatgtagccatagctacgctggaaaagaagctg
ctagcgcaacaagaggaacttacggacctgcacaagcggaagggtgaacactcccaaatg
attgtcgatttaaatctgaaagtggaacagcaaaaggagcttattgccgaacgggagcac
agtctctacgaacaacaaactgccaacaatcgcttacgggctgaggtgcagctgctacac
tccagcttagaagaacttaagaaactgaatacaacattgcttgatgagcacacggcgctt
caactggcgttcagttccctcgaggataagatgcgcaacgtacaggatgaaaatcgctac
ttgttggaaagattaatgcgctatagggccaaagatgccgataaactgaatgaggaaaac
gaaagtatcataagaaaacgttcggcaaaactgaaacgtgacctggaagacgccgttcgt
gaacccaattcggcaataaaccagatagttcctgcgaccggcagcaccccactgcatcgt
aactcgagtccagcccagtttagcgggactactgtgagtgacgaggaaatcgatgagggc
cttataaacggcgccatggaagccttgggactcaatgatgaggaatatatcagtgcaaga
ttcacagccggtgaaattggccatgatttagcacggatcggcacgaatatgtccatggaa
acacttaaggcggcaggctatctgggccagcccaatccgaccaaaatactgatgaagttt
gaagcccacgagaacgagtcgcatgcagtacgctggagtccggtagagcgcatggtagct
acgggcggcgccgatagaaaagtcaagctatgggatatcggcaaaagttctacggagccc
cgtgctgtgcttagtgggagtagtgccgggattaactctgtcgattttgactcgaccggc
gcttacattctgggtacatcaaacgattatggcgctcgagtatggactgtaatggataac
cggttaaggcacacactgacgggtcacagtggcaaggtgatggccgccaaatatgtccaa
gagccaattaaagtggttaccggaagtcacgaccgcactttaaagatctgggacttacgc
agcattgcctgcattgagaccaagtttgccggctccagttgcaatgatctgtgcacaacg
gatagcctcggctcgacaataattagtggccattatgataagaagatccgcttctgggat
atacgaacggaaaaacaagctgacgatgtgcttatgcctgccaaaatcacctcgctggac
ttatcaaaggattgcaattatctgatatgctctgtgcgagatgatacaataaaactatta
gacttacgcaagaatcaagttatatccacattttcaaacgagcattttaagatcagctgt
gatttcgctcgggcagcttttaataattgcgcttcgaagatcgcctgcggatcggcagac
ggtgcaatatatatatggaatgtgaacggatttctcgaaactacgctcaagggccacagc
acggccgtgaatgcagtcagttggagtccaaacagcaattcgctggcgtctgtggggaag
agtaaaagatgcatcatttactccgactcgtag

DBGET integrated database retrieval system