KEGG   Drosophila virilis: Dvir_GJ22433Help
Entry
Dvir_GJ22433      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dvi  Drosophila virilis
Pathway
dvi00450  Selenocompound metabolism
dvi00970  Aminoacyl-tRNA biosynthesis
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dvir_GJ22433
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dvir_GJ22433
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dvi01007]
    Dvir_GJ22433
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dvi03016]
    Dvir_GJ22433
Enzymes [BR:dvi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Dvir_GJ22433
Amino acid related enzymes [BR:dvi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dvir_GJ22433
Transfer RNA biogenesis [BR:dvi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dvir_GJ22433
 Prokaryotic type
   Other AARSs
    Dvir_GJ22433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 GST_C_3 tRNA-synt_1 GST_C_2 GST_C Anticodon_1
Motif
Other DBs
NCBI-GeneID: 6627170
NCBI-ProteinID: XP_002050955
FlyBase: FBgn0209545
UniProt: B4LNG8
Position
Unknown
AA seq 1016 aa AA seqDB search
MIIYTNEGNPLGLQLLMLAKFAKRAVQVQLVNLNDAKYKDLLVLPTLELDTGLRLFSTAA
IAKYLLGDEGQQRDEWLEWSTTLLAPALAHHMAVGHRADPNALPVLNGLVKKLDDCLRNA
PFLAGDKLSAADIAIWCLLAPDGTLKGAQHVDNLRSWYDKIKALPEVQQVLGEQPLKELS
FNALQQANRYGGLHHVPLRRSSSVDAGKLLAETAPTVADTVTDEEINAARAAFTYTKPKE
LAEARTVLPKAGERNVLITSALPYVNNVPHLGNIIGCVLSADIFARYSRSAGYNTLLICG
TDEYGTATENKALAENMTPREICDKYFELHNSIYRWFGIGFDYFGRTTTQEQTDIVQEAF
HDVYKAGYILTESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNAT
ELVRPRCKVCNSAPVLRSSDQLFLDLPKAEPQLREWVDRVEQGWTHNARVITRAWLREGL
KPRCITRDLKWGIPVPHKNFEKKVFYVWFDAPFGYVSMTKRYTKEYLQWWQPAAGTNVEL
FQFMAKDNVPFHSVVWPSVLLAINKGNTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQ
ETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFNST
VPQIVLNQDELVLLALINRELRGYINSLEKAKLRDGIRHLLAISRHGNGYMQTQQPWVLL
KGNDEQKSRAATIIGLCANIACLLANLLFPYMPSTARNLFAQLNAKQTPLDASKPLATIL
LPAGHKIGKPSPLFTKLEQAFIDELKGKYGGTQETRAEEPQQAAELEAAVQAQSDKVRQL
KASTKDKTVWQPEVNKLLELKKQLEAAQKTTPAAAAPAAATQSVQDLENAVQAQGEKVRQ
LKSSTKDKAVWQPEVNVLLALKKQLDAAKAAPAAAAPAAAVPTAAAPANVGADAGKIKAL
EDKIAQQGEKVRSLKASGDATIWKPELDVLLNLKKELAALTGAPAAGTQSKNKKKK
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgattatctacacaaatgagggcaatccgctgggcctgcagctgctgatgctcgccaaa
ttcgccaagcgtgcggttcaagtgcaattggttaacctaaatgatgccaagtacaaggat
ttgctggtgctgcctacgctcgaactggacactggcttgcgtttgttctccacggcagcc
atagccaaatatttactgggcgacgagggtcaacagcgggacgagtggctagagtggtcc
acaacactgttggcgccagcgctggctcatcatatggccgtcggtcatcgcgcggatccg
aacgccttgcctgtgctgaatggtctcgtcaagaagctggacgattgcctcaggaacgcg
ccctttttggcgggcgataagctaagcgccgcggatatagccatctggtgtttattggcg
ccagatggcaccctcaaaggtgctcaacacgtggacaatctgcgcagctggtacgataaa
ataaaagctctgcctgaggtccagcaagtgctaggggagcagcccttaaaggagcttagc
ttcaatgcgttgcagcaggcaaatcgttatggtggacttcatcatgtgccactcaggcgt
tccagctcggtggatgctggcaaactgctggccgagacagctcccaccgtggcagacacc
gttacggatgaggagatcaatgcggcacgcgctgccttcacatacacgaaaccaaaagag
ttggccgaagcacgcactgtgctgccaaaggctggagaacgtaatgtgctcatcacctca
gccctgccgtatgtcaataatgtaccacatctgggcaacattattggctgtgtgctatcc
gctgacatctttgcgcgctactcccgttcggctggatacaatacgctgctcatctgtggc
acggatgagtatggcacggccacggagaataaggctctggccgagaatatgacgccgcgt
gagatttgcgacaagtatttcgagctgcacaattccatttaccgctggttcggcattggt
tttgattactttggacgcaccaccacccaggagcaaaccgacattgtacaagaggctttc
cacgatgtctacaaagcgggctacatacttaccgagagtgtggagcagctgctgtgccaa
aaatgcgatcgtttcctagccgatcgctttgtagagggcacctgtccgcatcctggctgt
ggctatgaggacgcacgcggtgatcagtgcgacaagtgcggcaagctggtgaatgccacc
gaattggtgcgtccacgttgcaaggtgtgcaacagcgcgcccgtgctacgctcctcggat
caactgtttctggatctgcccaaagcggagccgcagttgcgcgagtgggttgatcgtgtt
gaacagggctggacgcataatgctcgggttataacacgagcctggctacgcgagggcctg
aagccgcgctgcattacgcgcgatctcaaatggggcatacccgtgccgcacaagaacttt
gagaagaaggtcttctatgtgtggttcgatgcaccgtttggctatgtgtccatgaccaaa
cgctacaccaaggagtatctgcagtggtggcagcctgccgctggcactaatgtggaactg
ttccagtttatggccaaggacaatgtgcccttccattcggtcgtgtggcccagtgtgctt
ctggccatcaacaagggcaacacgctggtcagccacatcatggccacggaatatctcaac
tatgaggatggcaaatttagcaagagtcgcggcataggcgtttttggcaatgatgcccag
gagacgggcatacccgctgacgtttggcgtttctatttggcatcggcacgtcccgagggt
caggattccagcttcagctggaacgatttggccgcacgcaacaactccgaattgctcaac
aatttgggcaactttgtcaatcgcgcattggtcttctgcgagaagaatttcaatagcact
gtgccgcaaattgtactcaaccaggacgaactggtgctcctggcgctcatcaatcgcgag
ctgcgtggctacatcaactccctggagaaggccaagctgcgcgacggcatacgtcatcta
ctggccatttcacgccatggcaatggctacatgcaaacccaacagccttgggtgctgctc
aagggcaacgatgagcagaagtcgcgcgctgccaccatcattggcctgtgcgccaatata
gcctgcctgctagccaatctgctcttcccctacatgcccagcacggcgcgcaacctgttc
gctcagctgaatgccaagcaaacgccactcgatgccagcaaacccttggccaccatccta
ttgccggcgggccacaagattggcaagccctcaccactgttcaccaaattggagcaggcg
ttcatcgatgagctcaagggcaaatatggcggcacacaggaaaccagggcggaggagccg
caacaagcagctgagctggaggcagcagtgcaggcgcagtcggacaaggtgcgtcaactg
aaggcgagcacaaaagacaagaccgtttggcagccggaggttaacaagctgctcgaactg
aagaaacagctggaagcggcgcagaagacgacgcccgcagcagcggcaccagctgcagcc
acacaatctgtgcaagatctagagaacgcagtgcaggcgcaaggcgagaaggtgcgtcag
ctcaagtccagcacaaaagacaaggcagtctggcagcccgaagtgaatgtgctgctcgct
ttaaagaagcaactggacgcggccaaggcagcgccagcagcagccgcgccagcagcagcc
gtgccaacagctgccgcgccagccaacgtcggcgcggatgcgggcaaaataaaagcactg
gaagacaaaatcgcacagcagggcgagaaggtgcgcagcctaaaggccagcggggatgcg
accatttggaagcccgagctcgatgtactcctaaatctgaagaaggagctggcggcgctg
actggcgcaccagcggctggcacgcagagcaagaataagaagaaaaagtaa

DBGET integrated database retrieval system