KEGG   Drosophila virilis: Dvir_GJ23564Help
Entry
Dvir_GJ23564      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dvi  Drosophila virilis
Pathway
dvi00860  Porphyrin and chlorophyll metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ23564
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dvir_GJ23564
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Dvir_GJ23564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 MCRA DAO Pyr_redox ATPase_gene1 Thi4
Motif
Other DBs
NCBI-GeneID: 6630599
NCBI-ProteinID: XP_002053018
FlyBase: FBgn0210661
UniProt: B4LW33
Position
Unknown
AA seq 481 aa AA seqDB search
MKTAVLGGGISGLSAGYYLLRKFGKPLTIYEASPRVGGWIRSEWHKERGFLFESGPRTIR
PKGIAGANTLELVDQLNLPIKPIRASHVAARNRMLYAKGQICLLPNSPRGLIGTVPPFTK
PLYRALLHDLTTGGTVAKNEDESIYSFAQRRFGKEIADYAISPMICGICAGDAREISVRF
LMESLFEKEQKYGGVIKGMLYSRFKNNVDESKVGLFDQDEPKLFKQAVQEKWAMYGLADG
LEQLPRALRKYLGEHDVNVQLSSKCHNLSFNNDGARISVRDVDLPVAHVVSSLPAHQLAP
LVRTQHPSLAAQLLDIPYVDVVVVNLQYNSDRLLKQNGFGLLVPPVEKLPVLGVIFDSCC
FDMAGNTILTVMMGGRWFDKWFGHQPSQKELRDIAQLHVRKILHIKEEPNFSRVHTLHKC
IPQYTVGHKRRVENIRSYIKNYKLPLSLCGAAYDGVGINDVILSARRQVNKLPVHQPPPG
H
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccgttctcggcggcggcatcagtggtttatccgccggctactatctattg
cgaaagttcggcaaacctttgaccatttacgaagcatcaccacgcgtcggtggctggata
cgttctgaatggcacaaggaacgcggttttttgtttgagagtggtccgcgcacgatacgg
ccaaaaggtatagcgggtgccaacaccttggaactggtggatcaactgaatctgccgatt
aagccaatacgcgcttcacatgtggcggcacggaaccgcatgctttatgccaagggccag
atctgtctgctgccaaacagtcccaggggtcttattggcactgttccccccttcacaaaa
cctctgtatagagctcttctccatgacttgaccactggcggcactgtggctaaaaacgaa
gacgagtccatctacagctttgcccaaaggcgattcggcaaggaaattgctgactacgcc
attagcccaatgatctgtggcatttgtgctggcgacgcgcgcgaaatcagtgtgcgtttt
ctcatggagagtctcttcgagaaagagcaaaaatatggcggcgtaataaagggtatgctc
tactcgcggttcaagaacaatgtagacgagagcaaagtaggtttgtttgatcaagacgag
cccaagctgttcaagcaagctgtccaagagaagtgggccatgtacggcctcgcggatggc
ctggaacagctgccgcgagctttgcgcaaatatctgggcgaacacgatgtgaacgtccag
ctaagcagcaagtgtcacaatttaagctttaacaacgacggcgctcgcattagtgtacgc
gatgttgacttgccggtggctcatgtggttagctcactgcctgcacatcaattggcaccg
ctggtgagaacgcagcatccgtcgctggccgcccaactgctggacataccatatgtggat
gtggtcgtggtcaacttgcaatacaacagtgatcggctcttgaaacaaaatggcttcggg
ttgctggtgccgcccgtcgaaaagctgcccgtgctgggagtcatcttcgatagctgctgc
tttgacatggctggcaacacgatattaaccgtcatgatgggcggccgctggttcgacaag
tggtttggccaccagcccagccaaaaggaattgcgcgacattgcacagctgcacgtgcgc
aagattcttcacatcaaagaagagcctaactttagccgcgtacacacgcttcacaagtgc
attccccagtacaccgtcggacataagcgacgcgtggagaacataaggagctacatcaaa
aactacaaactgccattgtcgctgtgcggcgcagcctatgatggcgttggcatcaacgac
gtcatattgtctgcccgcagacaggtaaacaagttgccggtgcaccagccgccgccgggt
cattga

DBGET integrated database retrieval system