KEGG   Drosophila virilis: Dvir_GJ24153Help
Entry
Dvir_GJ24153      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dvir_GJ24153
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dvir_GJ24153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 6630579
NCBI-ProteinID: XP_002053928
FlyBase: FBgn0211237
UniProt: B4M137
Position
Unknown
AA seq 382 aa AA seqDB search
MVRITWRTNSTQSLVSTFRLRWSYMNHCWHSLTFNAHMNSSYATDVCMTPIFWVVDNYTH
CLGPFFVVGVAILTTAVVGIAYWIGLPFWWAKSQVATILLLIVGNWLLLNIIFHYVMAVI
TPAGQPPEGVSHVEAVSMCTKCISPKPPRTHHCSVCNRCILKMDHHCPWLNNCVGYANHR
YFFLYMLYTTLGCLFLIVCGLEIGYKYLWLDHSEHWTELEPLEGHPVKFNLSGHAILVTH
PHEYDDILLPAAVHHLPTPIADTLADSTPTRRRILWFMAVTNVAVVIALGTLCTWHAKLI
TRGETSVEAHINEAERKRFLQLKRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWH
RPEGNGLSFHTVHDAIFEDEWP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcattacctggcgcacaaactccacacagagtctagtctccacatttcgccta
cgctggagctatatgaaccactgctggcactcgctcacctttaatgcgcacatgaattcc
agctatgccaccgacgtgtgcatgacgcccatcttctgggttgtggacaactatacacac
tgtctgggaccattcttcgttgtgggcgtggctatactgactactgccgtggtgggcatc
gcctattggattggcctgcccttttggtgggccaagagccaagtggcaacaatactgctg
cttattgtgggcaactggctgctgctaaacattattttccattatgtgatggctgtgata
acgcccgctggacagccaccagaaggtgttagccatgtggaggccgtcagcatgtgtacc
aaatgcatttccccaaagccgccgcgcacgcaccactgttccgtgtgcaatcgctgcata
ttgaagatggatcatcattgcccctggcttaataactgcgtgggttatgcgaatcatcgc
tacttctttctatatatgctgtacaccacgctgggctgcctgtttcttattgtgtgtggt
ctggagattggctacaaatatctctggctggatcacagcgagcactggacggaattggaa
ccgctcgagggtcatccagtcaaatttaatctaagcggacatgccatacttgttacgcat
ccgcatgagtacgatgacatcctgttgccagcagctgtacatcatttgcccacgcccatc
gcggacacgctggccgactccacgcccacacggcgtcgcattttgtggtttatggccgtg
accaatgtagctgtggtgattgccctgggcaccctttgcacctggcatgccaagctgatc
acgcgcggcgaaaccagcgtggaggcgcatattaatgaggctgaacgcaaaagattctta
caactcaaacgcatttacattaatccctataattttggcaccaaaaagaattggaaacta
tttctgggccttgtgcgtggcagatcgttttggcgcaccgtgttgctgccttcgtggcac
agacccgagggcaacggtcttagttttcatactgtgcacgatgcaatcttcgaggatgag
tggccatag

DBGET integrated database retrieval system