KEGG   Drosophila virilis: Dvir_GJ24161Help
Entry
Dvir_GJ24161      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dvi  Drosophila virilis
Pathway
dvi04013  MAPK signaling pathway - fly
dvi04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ24161
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dvir_GJ24161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dvi01009]
    Dvir_GJ24161
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dvir_GJ24161
    3.1.3.48  protein-tyrosine-phosphatase
     Dvir_GJ24161
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    Dvir_GJ24161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 6630955
NCBI-ProteinID: XP_002053945
FlyBase: FBgn0211245
UniProt: B4M154
Position
Unknown
AA seq 513 aa AA seqDB search
MCVCETSNSSYNYNNNSNNTATSTTRNCCERDGDSNSVSHKSEMKMRIKREAPCLLLFMP
IQNNNNNNNRIGANHKDYPNNKRSRENLACDEQQLTATSTSTAAMNVGSNGGRTPPLMRS
CSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQSPSESHLQGLKYMQ
IPASDTPHQNIKQYFQEAFDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLL
EAYKLVKVARPIISPNLNFMGQLLELEQSLRKSGVLAPLPVTPVASSQSPQVPLAATTSQ
LVEQPEQEAAAAVAHLAPTSRPLHSKSKSDSEAMDEDVYDYDDVDSGAGSFAGSNCSSRL
TSPPVTPDETPCTSAAAAATELDSPCSNSSSGIYSMSASRPFSAPNSYAAATPAPAATTA
APALLSPSRPLALFKRNSPVKLRLNLESNYTPNIPKSISCISIHNASLRSPLQREAPATP
SCEAAPTTPGDNNCSSSSSTSNNNNLVAATSSD
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgtgtgaaacgagcaacagcagctacaactacaacaacaacagcaacaatacg
gcaacgtcaacaacacgcaattgctgtgagcgcgacggagacagcaacagcgtgagtcat
aaaagtgaaatgaaaatgcggataaagagagaagcgccgtgtctactgctatttatgcca
atccaaaataacaacaacaacaacaatcgcattggtgctaatcacaaggactatcccaac
aacaaacggtccagggaaaatctggcatgtgacgaacagcagctgacggcgacgtcgacg
tcaacggcagcaatgaatgttggcagcaatggcggccgtacgccgccgctcatgcgcagc
tgctccagtccggcggtatacgatatcgaaacacatcccgcctcgccagtattcccacat
ctgctgctgggcaatggccgcgatgcggacgatcccagcagcgtgggcgccaattgtgtc
ctaaatgttacctgccaaagtcccagcgagagtcatctgcagggcctcaagtatatgcaa
atacctgccagcgatacgccccatcaaaatattaagcaatattttcaggaggcattcgat
ttcatagaggatgcacgcaaaacaggttcgcgcgtcttgttgcattgccatgcgggcatc
tcgcgcagcgccaccatcgccattgcctacgtcatgcggtacaagtcgctctcgctgctg
gaggcctacaagctggtgaaagtggcccggcccatcatttcgcccaatctgaactttatg
ggccagctgctcgagctggagcagagtctgcgcaagagcggcgtcctggcgccgctgccc
gtaacacccgttgccagcagtcaatcgccgcaagtaccgttagcggccacaactagtcag
ctcgtggagcagcccgagcaggaggcggcagctgctgtggcacatctggcgccaacgtcg
cgcccgctgcacagtaaatccaaatcggatagcgaggccatggatgaggatgtctatgat
tatgatgatgtggatagcggtgccggcagctttgccggcagcaattgctcatcgcgccta
acctcaccgcccgtcacaccggacgagacgccctgcacttcggcagctgcggctgccacc
gaactggactcaccctgttccaatagcagcagcggcatctactccatgtctgcgtcgcgg
ccctttagtgcgcccaatagttatgctgctgccacgcccgcacccgccgctaccacggca
gcgccggcgctgctgtcgccatcgcggccgctggcgctcttcaagcgtaactcgcccgtc
aagcttaggctcaatctggagtccaactatacgccaaacataccaaaatccatatcctgc
atatccatacacaatgccagcctgcgcagtccgctgcagcgggaggcgccagccacgccc
agctgcgaagcggcgcccactacgcccggcgacaacaactgcagcagcagcagcagcaca
agcaacaacaacaacctggtggcagccacgtcgagtgattga

DBGET integrated database retrieval system