KEGG   Drosophila virilis: Dvir_GJ24528Help
Entry
Dvir_GJ24528      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
dvi  Drosophila virilis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dvi01002]
    Dvir_GJ24528
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     Dvir_GJ24528
Peptidases [BR:dvi01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   Dvir_GJ24528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 6630048
NCBI-ProteinID: XP_002054567
FlyBase: FBgn0211608
UniProt: B4LYY4
Position
Unknown
AA seq 791 aa AA seqDB search
MLLVQKIRRCHQLGQLCQLRFRTAGSYTVAQHFQKQATRLLNFGQLRTTTSAFTAVNYST
RVNLPQPSVMASKTSHFVLPNTQPIADLDCKNAFENLTDKEKLYAHYFSKASWDGGLVSL
IQSSPEAPLIFSLLHRIFVAEKPAELKVKALKAGATEDDFTAFLVYACGVFANSGNYKGM
GDSKIVPNLAEDKFEAIVRSSAAYAAEPRVSKIYEKVKNLIYALEARNEVLGFAPNGVTT
YWSDNCTKEDSEIVNAWLTTKRIEPYMCRTFKVTENGKTFYDIKLGSVEQTSKEGITLAL
EEYNGNHFRVTRGDYQPLLKRVNENLLQAKKYAANDNETKMIEHYVKSFEEGSLAEHKDG
SRWWIKDKGPVIETYIGFIETYRDPAGGRAEFEGFVAMVNKESSAKFSELVNRAEKLLEY
LPWTEPYEKDSYLKPDFTSLDVLTFAGSGVPAGINIPNYDEIRQDEGFKNVSLGNVLANI
NRKDPIPFLSDADQTLMKEYKVKAFEVQVGLHELLGHGSGKLFRIDENGTHNFDVETVKN
LITGEPIKSWYKPGETYDTKFGAIGSSYEECRAEAVGLYLSLQRDILEIFGFKDAAEQDD
IIYINWLSLIWNGMGVALEMYNPKSKLWLQAHSRARFVIMKVLLEAGEGFVTVEETEGGK
NLLLTLDRSKIHTVGKKALGEFLTKLQVYKSTADIEAASKMYEHYSNVNEGGSHPWAKWR
DICLAHKKPRIILVQANTFINGDKVELKTYDATHEGYIQSWVERYPTTDIDDVLENIVEQ
DKKYFPIAYSK
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgttgctagttcagaaaattcgtaggtgccatcaactgggccagctttgccaattacgt
tttcgaacggccggcagttacactgtagcgcaacatttccaaaagcaggcaacgcgtctt
ctgaatttcggtcagctaagaacaacaacatctgcatttacagccgtcaattacagcaca
cgtgttaatttgccacaaccaagcgtaatggccagcaaaacttcgcatttcgtgttgcca
aacacgcagcccattgccgatttggattgcaaaaacgcatttgaaaatttaaccgacaag
gaaaagctgtacgctcactattttagtaaggcatcgtgggatggtggtttggtttccctc
atccagtccagcccggaggcgccccttatattttcgttattgcatcgcatttttgttgcc
gaaaaacccgccgagctgaaagtcaaagccttaaaagcgggcgctactgaagatgatttt
actgcattcctagtttacgcatgtggcgtgttcgccaattccggcaactacaagggcatg
ggtgatagcaaaatagtgcccaacttggcggaggataaatttgaggcgatcgtacgctct
tcggctgcctatgctgctgagccgcgcgtgtctaagatttatgagaaggtcaaaaatctg
atttatgctctggaagcacgtaatgaagtcctcggctttgcgccaaatggtgtaactaca
tattggtcggacaactgcaccaaggaggattcggaaatagtcaatgcttggctgacaacg
aagcgtatcgagccatacatgtgtcgtacatttaaagtgaccgagaacggaaaaacattt
tacgacattaagctcggttccgtggagcaaactagcaaggagggcataaccctggctctg
gaggagtacaatggcaaccattttcgcgttacacgtggcgactatcaacccttgctgaaa
cgtgtaaacgagaatttgcttcaagcaaaaaaatatgccgccaatgataatgagacaaaa
atgattgagcattatgtcaaatcctttgaggaaggctctttggccgagcataaggatggc
tccagatggtggatcaaggacaagggacccgttattgagacctacattggtttcattgaa
acgtaccgcgatccggcgggcgggcgtgccgaattcgagggctttgtggccatggtcaat
aaggaaagttcggctaaattttccgaattggtcaatcgtgccgagaaacttctagagtat
ttgccatggactgagccctatgagaaggattcatatttaaagccagatttcacgtcgcta
gatgtactgacttttgctggaagcggcgttcctgctggcattaatatacccaattatgac
gaaattcgtcaggatgagggctttaaaaatgtttcgctgggcaacgtgctggccaacata
aatcgcaaggatcccataccttttctatccgatgcggatcagacactcatgaaggaatat
aaggtgaaggcttttgaggtgcaagtgggtttgcacgagctgttgggacatggcagtggc
aaattgttccgcatcgatgaaaatggtactcacaactttgacgtggagacagtaaagaac
ctcataactggcgagcctattaagagttggtataagcctggcgagacgtacgatacaaaa
ttcggtgctattggttcatcctacgaagagtgccgcgctgaggcagtgggcctttattta
tctctgcagcgggatatactggaaatatttggttttaaagacgctgcagagcaggacgat
atcatttacatcaattggcttagccttatttggaacggcatgggtgttgccctggaaatg
tacaatcccaaatctaaactgtggctccaggcacattcgcgtgcacgtttcgttatcatg
aaagtattgctcgaagctggcgaaggatttgttaccgttgaagagaccgagggtggtaaa
aatctactgctcacattggaccgtagcaaaattcataccgtcggcaagaaagcgctgggc
gaattcttgaccaagctgcaggtgtataaatccacagccgacatcgaagcagcttccaaa
atgtacgaacactattcgaacgtgaacgaaggcggatcgcatccttgggccaagtggcgt
gatatatgcctggcgcacaaaaaaccacgcattattctggtgcaggctaacacatttatt
aatggtgacaaagttgaattaaagacttatgatgctactcatgagggctacatacagtct
tgggtagagcgttatcccactactgatattgatgatgtactagaaaatattgtagagcag
gataagaagtacttccctattgcttattcaaagtaa

DBGET integrated database retrieval system